KEGG   Sphingobium yanoikuyae: A6768_23595Help
Entry
A6768_23595       CDS       T05170                                 

Definition
(GenBank) YihY/virulence factor BrkB family protein
  KO
K07058  membrane protein
Organism
sya  Sphingobium yanoikuyae
Brite
KEGG Orthology (KO) [BR:sya00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    A6768_23595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ATI82688
UniProt: A0A084EEC6
LinkDB All DBs
Position
5094064..5094987
Genome map
AA seq 307 aa AA seqDB search
MAAQAQEKFHRQIDRVRPGSRSFEIAKRVMVGVYSDGFIHAGNLAYLSLMTLFPFFIVAA
AVASVFGRTSDGLSAVNAFLYTVPRGVADVVRQPISDVLQARSGNLLWFGGLVGLWTVGS
LIETIRDILRRAYGTKSTKPFWRYRLASVGITLVSVLAVMFAFSMQVMITAVDQLLHRLL
PFADEAIAWVSSAKLVPMAILCVALHSLYVSLTPSLYRDKRFPKWPGAVATALWWYAVTL
LLPVTLSMLGGYDRTYGSLAGVMITLIFFFLVGLGVVIGAELNAALAEFPEDEAAGTVQD
KGNGTTI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcaggcgcaggagaaattccatcgccagatcgatcgggtccggccgggatcg
cgcagcttcgagatcgccaagcgggtgatggtgggcgtctatagcgacgggttcatccat
gcggggaacctggcctatctctcgctgatgacgctgtttcccttcttcatcgtcgccgcc
gccgtcgccagcgtctttggccgcacgtcggacgggctgtcggcggtgaatgcctttctc
tataccgtgccgcgcggcgttgccgatgtcgtgcgccagccgatcagcgatgtgttacag
gcgcgttccggcaatctgctctggttcggtggtctggtggggctctggaccgtgggcagc
ctgatcgagacgatccgcgacatattgcgccgcgcctatgggacgaagagcaccaagccc
ttctggcgttatcggctggcgtcggtcgggatcacgctggtcagcgtgctggcggtgatg
ttcgccttttcgatgcaggtgatgataacggcggtggaccagctgctccaccggctgctg
cccttcgcggatgaggcgatcgcctgggtttcctcggccaagctggtgccgatggcgata
ttatgcgtggcgctccactcgctctatgtctcgctgaccccgtcgctctaccgtgacaag
cgctttcccaaatggcctggcgccgtcgccaccgcgctctggtggtatgccgtcactctg
ctattgccggtcacattgtcgatgctgggcggctatgaccggacctatggcagtctggcc
ggtgtcatgatcaccctcatttttttctttctcgtggggctcggcgtggtaattggcgcc
gaattgaatgcggcactggcggaatttccggaagacgaagcagccggcaccgtgcaggac
aaagggaacggaacgacgatatga

DBGET integrated database retrieval system