KEGG   Sphingobium yanoikuyae: A6768_23600Help
Entry
A6768_23600       CDS       T05170                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00061  Fatty acid biosynthesis
sya00780  Biotin metabolism
sya01100  Metabolic pathways
sya01130  Biosynthesis of antibiotics
sya01212  Fatty acid metabolism
Module
sya_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A6768_23600
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A6768_23600
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A6768_23600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sya01004]
    A6768_23600
Enzymes [BR:sya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A6768_23600
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A6768_23600
Lipid biosynthesis proteins [BR:sya01004]
 Fatty acid synthase
  Component type
   A6768_23600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ATI82689
UniProt: A0A085K9A4
LinkDB All DBs
Position
5094984..5095790
Genome map
AA seq 268 aa AA seqDB search
MTGLMAGKRGLIMGLANDKSLAWGISQQLHAQGAELAFSYQGEALAKRVKPLAEQLGSDF
LIDCDVSDMAKLDEAFAEIEARWGKLDFVVHAIGFSDKNELRGLYADTSLDNFLMTMNIS
VYSFVAVAARARKLMKEGGSLLTLSYYGAEKVIPHYNVMGVAKAALETSVKYLAMDLGPE
NIRVNAISAGPIKTLAASGIGDFRYIMKWNELNSPLRRNVTIDDVGGAGLYLLSDLASGV
TGEIHHVDAGYNVIGMKAEDAPDIALDK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcttgatggcgggaaagcgcgggctcatcatggggctggcgaacgacaagtcg
ctggcttggggtatttcgcagcaactgcatgcgcagggcgcggaactggccttctcctac
cagggcgaggcgctggccaagcgcgtcaagccgctggcggaacagctgggctcggacttc
ctgatcgactgcgacgtgtccgacatggcgaagctggacgaggcttttgccgagatcgag
gcgcgctggggcaagctggacttcgtggtccatgccatcggcttttccgacaagaacgag
ctgcgcggcctctatgccgacaccagcctcgataatttcctgatgaccatgaacatctcg
gtctacagcttcgtcgccgtcgcggcccgcgcgcgcaagctgatgaaggaaggcggcagc
ctgctgacgctgagctattatggcgcggaaaaggtcatcccccattataacgtcatgggc
gtggccaaggcggcgctggaaaccagcgtcaaatatctggcgatggacctgggcccggaa
aatatccgcgtcaacgcgatctcggccggcccgatcaagacgctggccgccagcggcatc
ggtgatttccgctacatcatgaagtggaacgagctgaactcgccgctgcgtcgcaacgtg
acgatcgacgatgtcggcggtgccggcctctacctgctgtcggacctcgcttcgggcgtg
acgggtgagatccaccatgtcgacgcgggctataatgtcatcggcatgaaggccgaagac
gcgcccgacatcgcgctggacaagtaa

DBGET integrated database retrieval system