KEGG   Sphingobium sp. YBL2: TZ53_00810Help
Entry
TZ53_00810        CDS       T03855                                 

Definition
(GenBank) membrane protein
  KO
K07090  uncharacterized protein
Organism
syb  Sphingobium sp. YBL2
Brite
KEGG Orthology (KO) [BR:syb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    TZ53_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE Na_Pi_cotrans
Motif
Other DBs
NCBI-ProteinID: AJR22541
UniProt: A0A0C5XCU8
LinkDB All DBs
Position
165646..166425
Genome map
AA seq 259 aa AA seqDB search
MIPSPETIAFLMAAALMAGCIDAMAGGGGLIALPALLAAGIPPVPAVATNKLQSSLGTFG
ACVAYARAGHMDLKAYRWPIFAAFAGSVGGAWLVQRVDPSILAGLMPALLIALAAYFTFS
PKMSEIDRHQRIGMVLLSLLIGVIGFYDGFFGPGAGAFYTSIFIALGGLGLVRATAQTKA
ANFASNLAGLLTMIAGGHVIWIVGLAMAVGSIAGGQIGSRLAMRFGSRLIRPLLIVMSLA
LTAKMLLDPENPIHALLFG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcccttctcctgaaaccatcgccttcctcatggccgccgcgcttatggcgggatgc
atcgacgcaatggcgggcggcggcgggctgatcgccctgcctgccttgctcgctgccgga
atcccgcccgttccggcggtcgccaccaacaagctgcaatcctcgctcggcaccttcggc
gcctgcgtggcctatgcgcgggcgggacatatggatctgaaggcctatcgctggccgata
ttcgccgccttcgcagggtcggtcggcggggcgtggctggtgcagcgggtcgatccatcc
atcctcgcggggcttatgcctgcgctgctgatcgcgctggcggcctatttcaccttttcg
cccaagatgagcgagatcgaccggcaccagcgcatcggcatggtgctgctgagcctgctg
atcggcgtcatcggcttttacgacggctttttcggaccgggtgcgggcgccttctacacc
agcatcttcattgcgctgggcggcctgggcctcgtgcgcgccaccgcgcagaccaaggca
gccaatttcgccagcaacctcgccggcctgcttaccatgatcgcgggcgggcatgtgatc
tggatcgtcggcctcgccatggcggtgggcagcatcgccggcgggcagatcggatcgcgc
ctcgccatgcgcttcggcagccgcctgatccggccgctgctgatcgtcatgtcgctggcg
ctgacggcgaagatgctgctcgaccctgaaaaccccatccacgcgctgctgttcggctga

DBGET integrated database retrieval system