KEGG   Sphingobium sp. YBL2: TZ53_00905Help
Entry
TZ53_00905        CDS       T03855                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00473  D-Alanine metabolism
syb00550  Peptidoglycan biosynthesis
syb01100  Metabolic pathways
syb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TZ53_00905
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TZ53_00905
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    TZ53_00905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syb01011]
    TZ53_00905
Enzymes [BR:syb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TZ53_00905
Peptidoglycan biosynthesis and degradation proteins [BR:syb01011]
 Precursor biosynthesis
  Amino acid ligase
   TZ53_00905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AJR22559
UniProt: A0A0C5X0I6
LinkDB All DBs
Position
complement(187474..188439)
Genome map
AA seq 321 aa AA seqDB search
MTRGPWHVAVLMGGWSAERPVSLSSGEGVAKALESRGHRVTRIDMDRDVALRLAEARPDV
VFNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGHIV
PSESLFEGDPLPRPYVVKPVNEGSSVGVAIVTRDGNYGSPIGRDVEGPWLHFEELLAEPY
IRGRELTTAVLGDEALLVTELRPKSGFYDFDAKYTDGMTEHVCPADIPQEISEACKAIAL
RAHRLLGCKGASRADFRWDDEQGVDGLFLLEVNTQPGMTPLSLVPEQAARLGIDYAELVE
RIVEDALNGARIAANGGAKHG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtggcccctggcatgttgccgtcctgatggggggctggtccgccgaacggccc
gtttcgctttcgtcgggcgagggcgtcgccaaggcgctggaatcgcgcggccacagggtt
acgcggatcgacatggaccgcgacgtcgcgctgcgccttgcggaggccaggcccgatgtc
gtgttcaacgcccttcacggcgtgcccggcgaggatggcacggtgcagggcatgatggac
ctgatgggcctcacctacacccattccggcctcgccacctcggtcatcgcgatcgacaag
cagcttaccaagcaggcgctggtgccccatggcatccccatgcccggcggccatatcgtg
cccagcgaaagcctgttcgagggcgatcccctgccgcgcccctatgtggtgaagccggtc
aatgagggcagttcggtcggcgtcgccatcgtgacccgggacggcaattatggatcgccc
atcggccgggatgtcgagggaccgtggctgcatttcgaggaattgctggccgagccctat
attcgcggccgggaactcacgaccgccgtgctgggcgacgaagcgctgctggtcacggaa
ttgcgcccgaaaagcggcttctacgatttcgacgccaaatataccgacggcatgaccgag
catgtgtgtcccgccgatattccgcaggagatcagcgaagcctgcaaggcaatcgcgttg
cgcgcgcatcggttgctgggctgcaagggggcgtcgcgcgccgatttccgttgggacgat
gaacagggggtcgacgggctgttcctgctggaagtgaacacccagccgggcatgacgccg
ctcagtctcgtgcccgaacaggcggcgaggctgggcattgactatgccgagctggtggag
cgtatagtcgaggacgcgctgaacggcgcccgaattgcagccaatgggggggcgaagcat
ggctga

DBGET integrated database retrieval system