KEGG   Sphingobium sp. YBL2: TZ53_03130Help
Entry
TZ53_03130        CDS       T03855                                 

Definition
(GenBank) hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00361  Chlorocyclohexane and chlorobenzene degradation
syb00625  Chloroalkane and chloroalkene degradation
syb01100  Metabolic pathways
syb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TZ53_03130
   00361 Chlorocyclohexane and chlorobenzene degradation
    TZ53_03130
Enzymes [BR:syb01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     TZ53_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AJR22908
UniProt: A0A0C5XPW9
LinkDB All DBs
Position
644061..644687
Genome map
AA seq 208 aa AA seqDB search
MADIAAVVFDVGNVLYHWTPRVLYERLIDDDRALDAFLRDVVTLDWHFQHDQGRPFAETS
AELIARHPEHAALIRLWGEKFIDSVGPAVEGMPEIVLELHEGGIPLFAITNFSHEFWAPF
HARESALFAPFRDIVVSGAEKLVKPDPAIYRLALERFGLSAEQALFIDDREENVLAAEAE
GMRGHLFRDAATLRRELAELALLRSPTV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcggatattgccgccgtcgtctttgacgttggcaatgtcttgtatcactggacccca
agggttctgtacgagcgcctgatcgatgacgatcgggcgctcgatgcgtttctccgcgac
gtggtgacgctggactggcacttccagcatgaccagggccgccccttcgcggaaaccagc
gcagagctgatcgcgcgccatcccgaacatgcggcgctgattcgcctctggggcgagaag
ttcatcgacagcgtaggaccggcagtcgagggcatgccggagatcgtccttgaattgcac
gagggcggcattccgctcttcgccatcaccaatttcagccatgaattctgggcgccattc
catgctcgggagtcggcgctgttcgcccccttccgcgacatcgtggtctccggcgcggaa
aagctggtgaagcccgaccccgcgatctaccggctggcgctggagcgattcggtttgagc
gcggaacaggcgctgttcattgatgaccgcgaggaaaatgtcctggcggccgaggcggaa
ggcatgcgcggccacctgttccgcgatgcggcgacgctgcgccgggaactggcagagctg
gcgttgcttcgaagcccaaccgtctaa

DBGET integrated database retrieval system