KEGG   Sphingobium sp. YBL2: TZ53_03165Help
Entry
TZ53_03165        CDS       T03855                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00620  Pyruvate metabolism
syb00680  Methane metabolism
syb01100  Metabolic pathways
syb01120  Microbial metabolism in diverse environments
syb01200  Carbon metabolism
Module
syb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TZ53_03165
  09102 Energy metabolism
   00680 Methane metabolism
    TZ53_03165
Enzymes [BR:syb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TZ53_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5
Motif
Other DBs
NCBI-ProteinID: AJR26138
UniProt: A0A0C5XYA5
LinkDB All DBs
Position
complement(648919..651618)
Genome map
AA seq 899 aa AA seqDB search
MATLASSPAPAITQNPDIRFLGRLLGDVIRAYGGEKIYKQTEYIRSASVDRARGLHGADV
VDTGLDALSLDDTLSFVRGFMLFSMLANLAEDRQGVAAEPGADVASAVEKLRSHGIEREA
VLDLLSHALIVPVLTAHPTEVRRKSMIDHKNRIADLMLLKDGGRTETDEGENLDEAIFRQ
IALLWQTRPLRREKLFVADEIENVLAYFRDVFLPVLPALYARWERVLGARPQSFLRVGNW
IGGDRDGNPFVQAPQLRLALARGCEAALGFYMDALHALGAELSLSTELADVSQAVLDLAD
ASGDVSPSRQDEPYRRAISGIYARLAATYRSLVGKAPSRPSALKGEPYASPADLRRDLVT
VAQGLASEGNGALATGGALGRLIRAVETFGFHLATLDMRQNSDVHQSVVAELLKVAGVEA
DYAGLDEYARIALLRRELANNRPLGTAFFEYSEQTASELAIVHSAAEAHRIYGPQCITHY
IISKAESVSDLLEVNIILKEAGLWRAGTEGAPPQAAIMAVPLFETIADLEAAPKIMAAYF
GLPEIGGVVRERGHQEVMIGYSDSNKDGGYITSTWGLFQASKALAPVFAEAGTAMQLFHG
RGGAVGRGGGSSFAAIQAQPKGTVQGRIRITEQGEVIAAKFGTRDVAMTNLEAMTSATLL
ASLEPEVLSDRDAARFAAAMDQLSKTAFAAYRDLVYGTEGFKEFFRQLTPIQEISGLKIG
SRPASRTKSTRIEDLRAIPWVFSWAQARVMLPGWYGVGHALSAFEDKALLADMAQHWSFL
QSALANLEMVLAKSDLGIAAHYLPLVEDQARGAEIFDRIRDGWDMAHDGLLAATAQSRLL
EKNPKLDTSIRLRLPYIEPLNLLQVELMKRHRSGEDDPRIKEGIELSINAIATALRNSG
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcttgcatcctctcccgctcctgcgatcacgcagaacccggacatccgcttt
ctcggtcgtttgttgggcgacgtcatccgcgcctatggcggggagaaaatctacaagcag
accgaatatatccgctccgcctcggtcgatcgggcgcgcggcctgcacggcgcggacgtg
gtcgacaccggactcgacgcgctgagcctcgacgacacgctgagcttcgtgcgcggcttc
atgctcttctcgatgctggccaatctggccgaggaccgccagggcgtcgctgccgagccg
ggggccgacgtcgcctccgccgtcgaaaagctgcggtcccatggaatagagcgcgaggcg
gtgctcgacctgctgtcccatgccctgatcgtgccggtcctgaccgctcacccgaccgag
gtgcggcgcaagagcatgatcgaccacaagaaccgcatcgcggacctgatgctgctcaag
gacggcggccggacggaaaccgatgagggcgagaatctggacgaggcgatcttccgccag
atcgcgctgctgtggcagacccggccgctgcgccgggaaaagctgttcgtcgcggacgag
atcgagaatgtcctcgcttatttccgcgacgtcttcctgcccgtgctgcccgccctctac
gcccgatgggaacgggtgctgggcgcgcgcccgcagagtttcctgcgcgtcggcaactgg
atcggcggcgaccgcgacggcaatcccttcgttcaggcgccgcagcttcggctcgcgctc
gccaggggctgcgaggctgcgctgggcttttatatggatgcgctccacgcccttggcgcg
gaactgtcgctctcgaccgaactggccgatgtgtcgcaggccgttctggacctggccgac
gccagcggcgacgtctcgcccagccgtcaggacgagccctatcgccgggcgatttccggc
atctatgcccgtctggccgccacctaccggtcgctggtcggcaaggcgccgtcccgcccc
tcggcgctcaagggcgaaccctatgccagccccgccgacctgcgccgcgacctggtgacg
gtcgcgcaggggctggcgagcgaaggcaatggcgctctggcgaccggcggcgcgcttggc
cgcctgatccgcgcggtcgaaaccttcggcttccatctcgccacgctcgacatgcggcag
aacagcgatgtccatcagagcgtggtggccgaactgctgaaagtcgcgggggtcgaagcg
gactatgccgggctcgacgaatatgcccgcatcgccctgcttcggcgggagttggcgaac
aaccggccgctgggcacggcctttttcgaatattcggaacagaccgcgtccgaactcgcc
atcgtccattcggcggcggaggcgcatcgcatctacggcccgcaatgcatcacccattat
atcatctccaaggcggagagcgtttccgacctgctcgaggtgaacatcatcctcaaggaa
gcgggcctgtggcgcgcgggcacggagggcgcgccgccgcaggccgcgatcatggccgtg
ccgctgttcgaaaccatcgcggaccttgaggccgcgcccaagatcatggccgcctatttc
ggcctgcccgaaataggcggcgtggtgcgggaacgcggccatcaggaagtgatgatcggc
tattccgacagcaacaaggacggcggctacatcacctccacctgggggctgttccaggcg
agcaaggcgctggcccccgtctttgccgaagcgggcacggcgatgcagctattccatggc
cgcggcggcgcggtcgggcgcggtggcggctcctccttcgcggcgatacaggcgcagccc
aagggcacggtgcagggtcgcatccgcatcaccgaacagggggaggtgatcgccgccaaa
ttcggcacccgcgacgtcgccatgaccaatttggaagcgatgaccagcgcgaccctgctc
gccagtctggaacccgaagtcctgtccgatcgcgatgccgcccgcttcgccgccgccatg
gaccaactgtcgaagaccgccttcgccgcctatcgcgatcttgtttatggtactgagggc
ttcaaggaattcttccggcaattgaccccgatccaggaaatctccggcctcaagatcggc
tcccgtccggccagccgcaccaagagcacccggatcgaggatttgcgcgccatcccctgg
gtgttcagctgggcgcaggcgcgggtgatgctgccgggctggtatggggtcggccacgcg
ctttccgccttcgaggacaaggcgctgctggccgacatggcgcagcactggtccttcctg
caatcggcgctcgccaatctggagatggtgctggccaagtccgatctgggtatcgctgct
cactatctgccgctggtcgaggatcaggcgcggggcgcggagattttcgaccgcatccgc
gatggttgggacatggcccatgacggcttgctcgccgccaccgcccagtcgcggctgctg
gagaagaatcccaagctcgacacgtcgatccgcctgcgcctgccctatatcgagccgctg
aaccttcttcaggtcgaactgatgaagcgccaccgcagcggtgaggacgacccgcgcatc
aaggaaggcatagaattgtcgatcaacgcgatcgccacggcgctgaggaatagcggatag

DBGET integrated database retrieval system