KEGG   Sphingobium sp. YBL2: TZ53_09075Help
Entry
TZ53_09075        CDS       T03855                                 

Definition
(GenBank) monooxygenase
  KO
K16244  phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00361  Chlorocyclohexane and chlorobenzene degradation
syb00362  Benzoate degradation
syb00623  Toluene degradation
syb01100  Metabolic pathways
syb01120  Microbial metabolism in diverse environments
syb01220  Degradation of aromatic compounds
Module
syb_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TZ53_09075
   00361 Chlorocyclohexane and chlorobenzene degradation
    TZ53_09075
   00623 Toluene degradation
    TZ53_09075
Enzymes [BR:syb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     TZ53_09075
    1.14.13.244  phenol 2-monooxygenase (NADH)
     TZ53_09075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmoB_DmpM
Motif
Other DBs
NCBI-ProteinID: AJR23854
UniProt: A0A0C5X3Z1
LinkDB All DBs
Position
1976879..1977151
Genome map
AA seq 90 aa AA seqDB search
MSSTVFLALQANDDTRHVIDAIMADNPAASLDPQPAMVRITAPGTLVVRRETIEELIGRD
FDLQELHVNMISLSGRVDETDDIFTLSWDR
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccgtcttcctcgcgcttcaggccaatgacgacacccgccatgtcatcgac
gcgatcatggcggacaatcccgccgccagcctggacccgcagccggcgatggtgcgcatc
accgcgccgggcacgctggtcgtgcgccgcgaaacgatcgaagagctgatcggccgcgat
ttcgaccttcaggaactgcacgtcaacatgatctccctgtcgggccgcgtggacgagacc
gacgacatcttcactctgagctgggaccgctga

DBGET integrated database retrieval system