KEGG   Sphingobium sp. YBL2: TZ53_13850Help
Entry
TZ53_13850        CDS       T03855                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
syb  Sphingobium sp. YBL2
Brite
KEGG Orthology (KO) [BR:syb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TZ53_13850
Enzymes [BR:syb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TZ53_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C NAD_binding_8 DAO Glutaredoxin Thi4 FMO-like K_oxygenase Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: AJR24650
UniProt: A0A0C5XJM9
LinkDB All DBs
Position
complement(3002046..3003626)
Genome map
AA seq 526 aa AA seqDB search
MLDANLKAQLKAYMANITQPIELVASLDDSPKSRELKTLLDEIAELSDKVTIAAGNASRV
PSFMIRRTGTDIGVTFAGLPMGHEFTSLVLALLQVGGHPSKAAQDLIQQIRDIDGDFAFE
TYFSLSCQNCPDVVQALNLMSVLNPRISHTAIDGALFKEEVDARKVMAVPTVFLNGEPFA
SGRMELEQIVAKIDSGAAARAAEKIKAQDPFEVLVVGGGPAGAAAAIYAARKGIRTGVAA
ERFGGQVLDTMDIENFISVSRTEGPKLASALEAHVKDYDVEIMNLQKAAKLIPARAEGGY
HEVVLENGASLKGRTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEYDSQLRADAVLQRKLASLPNVRIITSALTTRVDGNGE
KVTGLSYKDRNGGTEHDVELEGIFVQIGLVPNTEWLKDAIALSPRGEIEIDARGETSQPG
IFAAGDCTTVPYKQIVIAMGAGSTAALSAFDYLIRLPATEETAEAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctgaaggcccagctcaaggcctatatggcgaacatcacccagccg
atcgagctggtcgcatcgctggacgacagccccaagagccgcgaactcaagacgctgctg
gatgagatcgccgaactgtcggacaaggtgacgatcgccgccggtaacgccagccgcgtc
cccagcttcatgatccgccgcaccggcacggacatcggcgtcaccttcgccggcctgccc
atggggcatgaattcacctcgctcgtgctggcgctgctccaggtcggcggccatccgtcg
aaggcggcgcaggacctgatccagcagatcagggatattgacggcgacttcgccttcgaa
acctatttctcgctctcctgccagaactgccccgacgtggtgcaggcgctgaacctgatg
agcgtgctcaacccgcgcatcagccacaccgccatcgacggcgcgctgttcaaggaagag
gtcgacgcgcgcaaggtcatggccgtccccaccgtcttcctgaacggcgaacccttcgcc
agcggccgcatggagctggagcagatcgtcgcgaagatcgacagcggcgcggcggcccgc
gcggcggagaagatcaaggcccaggacccgttcgaggtgctggtggtgggcggcggcccc
gccggcgcggcggcggccatctacgcggcgcgcaagggcatccgcaccggcgtcgcggcg
gaacgcttcggcggccaggtgctcgacaccatggacatagagaatttcatctcggtcagc
cgcaccgaagggcccaagctcgcctccgcgctggaagcgcatgtgaaggactatgatgtc
gagatcatgaacctccagaaggcggcgaagctgatcccggccagggccgaaggcggctat
cacgaagtcgtcctcgaaaatggcgcgtcgctcaagggccgcaccgtcatcctctccacc
ggcgcccgctggcggcagatgggcgtgcccggcgaggatgaatatcgcaacaagggcgtc
gcctactgcccccattgcgacggtccgctgttcaagggcaagcgcgtcgcggtgatcggc
ggcggcaacagcggcgtggaggcggcgatcgacctcgccggcatcgtcgcccatgtgacg
ctgatcgaatatgacagccagctccgcgccgacgccgtgctccagcgcaagctcgccagc
ctgcccaatgtcaggatcatcacctcggccctgacgaccagggtcgacggcaatggcgag
aaagtgaccggcctcagctacaaggaccgcaacggcggcacggagcatgatgtcgagctg
gagggcattttcgtccagatcggcctcgtccccaacaccgaatggctgaaggacgcgatc
gccctctccccgcgcggagagatagagatcgacgcgcgcggcgaaaccagccagccgggc
atcttcgcggcaggcgactgcacgaccgtgccctacaagcagatcgtgatcgccatggga
gccggatcgacggcggcgctgtccgccttcgactatctcatccgcctccccgcgacggag
gaaaccgcggaagcggcctga

DBGET integrated database retrieval system