KEGG   Sphingobium sp. YBL2: TZ53_19125Help
Entry
TZ53_19125        CDS       T03855                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb03030  DNA replication
syb03410  Base excision repair
syb03420  Nucleotide excision repair
syb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:syb00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TZ53_19125
   03410 Base excision repair
    TZ53_19125
   03420 Nucleotide excision repair
    TZ53_19125
   03430 Mismatch repair
    TZ53_19125
Enzymes [BR:syb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TZ53_19125
    6.5.1.6  DNA ligase (ATP or NAD+)
     TZ53_19125
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TZ53_19125
DNA replication proteins [BR:syb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TZ53_19125
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TZ53_19125
DNA repair and recombination proteins [BR:syb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TZ53_19125
   NER (nucleotide excision repair)
    Other NER factors
     TZ53_19125
   MMR (mismatch exicision repair)
    Other MMR factors
     TZ53_19125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N Dimerisation
Motif
Other DBs
NCBI-ProteinID: AJR25531
UniProt: A0A0C5XL64
LinkDB All DBs
Position
4153766..4155349
Genome map
AA seq 527 aa AA seqDB search
MRAFSRLLDGLVYTRSRNGKLDLIASYMRSAPDPDRGWALAALTGNLDLKAVKASTIAEM
TRARVDPVLFEMSRDYVGDLAETVALLWPKAEDQPPEVDDGSLTLSAIVDRLHATSRAAA
PTTLARMMDHLDASGRFALLKLATGGLRVGISARLAKTGFAQAFGLDVDDVEECWHALAP
PYADLFAWAEGRSDRPDPAGTPFFRPFMLAHPLEAESVDLSDYAAEWKWDGIRIQIVGTG
AQTRLYSRAGDDITGSFPDIAEAFRHHAVLDGELLVKGEFQGGEAASFNALQQRLGRKAV
TAKMMDDYPAFVRLYDILLDAEEDLRPLPWEQRRLRLEATVPQLDPHRFDISALIEAPDF
DSLAEIRAGARDAAIEGVMLKRRDSPYVAGRKAALWYKWKRDPLTADCVMMYAQRGHGKR
SSFYSDYTFGCWTADGELLPVGKAYSGFTDEELKWLDRFVRTNTVNRFGPVREVEKSLVL
EVAFDSIHESKRHKSGLAMRFPRIARIRKDKPAHEADTVEGLRRLVN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttctcccggcttctcgacggcctcgtctacacccgctcccgcaacggcaag
ctggaccttatcgccagctacatgcgcagcgcccccgacccggaccggggctgggcgctc
gccgccctcaccggcaatctcgacctgaaagcggtcaaggcttccaccatagcggaaatg
acccgcgcccgcgtcgatccggtccttttcgaaatgagccgggactatgtgggcgacctc
gccgaaaccgtggccctcctctggcccaaggcggaggaccagccgccggaggtggacgac
ggctccctcaccctatccgccatagtcgaccgcctccacgccaccagccgcgccgccgcc
ccgacgaccctggccaggatgatggaccatctcgacgcctccggccgcttcgccctgctg
aagctcgcgaccggcggcctgcgcgtcggcatctccgcccggctcgccaagaccggcttc
gcccaggccttcgggctcgacgtcgacgatgtcgaggaatgctggcacgcactggcccca
ccctatgccgacctgttcgcctgggcggagggcaggtcggaccgcccggatcccgccggc
acgcccttcttccgccccttcatgctcgctcatccgctggaggccgaaagcgtcgacctt
tccgactatgccgccgaatggaaatgggacggcatccgcatccagatcgtcggcacgggc
gcgcagacccgcctctacagccgcgccggagacgacatcaccggcagcttccccgacata
gccgaagccttccgccatcatgcggtgctggacggagaactgctcgtgaaaggggagttt
cagggcggagaggctgccagcttcaacgccctccagcaacgcctcggccgcaaggcggtg
acggcgaagatgatggacgattatcccgccttcgtccgcctctacgacatattgctcgac
gcggaggaggaccttcggccgctcccctgggaacagcgccgcctccgcctcgaagccacc
gtgccccagctggacccgcaccgcttcgacatctcggccctcatcgaagcacccgatttc
gacagcctggcggaaatacgcgccggcgcccgcgacgccgcgatcgagggcgtgatgctc
aagcgccgcgacagcccctatgtcgcggggcgcaaggccgcgctctggtataaatggaaa
cgcgatccgctgaccgccgactgcgtgatgatgtacgcgcagcggggccatggcaaacgc
tcctccttctattccgactataccttcggctgctggacggcggatggcgaactgctgccc
gtcggcaaagcctatagcggcttcaccgacgaggagctgaaatggctcgaccgcttcgtg
cggaccaacacggtcaaccgcttcggcccggtgcgggaggtggaaaagtcgctggtgctg
gaggtcgccttcgacagcatccacgaaagcaagcggcataaatcggggctggccatgcgc
ttcccccggatcgcgcgcattcggaaggacaagcctgcgcatgaggcggatacggtggag
ggattaagacggttggtgaactga

DBGET integrated database retrieval system