KEGG   Sphingobium sp. YBL2: TZ53_20990Help
Entry
TZ53_20990        CDS       T03855                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
syb  Sphingobium sp. YBL2
Pathway
syb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TZ53_20990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syb02000]
    TZ53_20990
Enzymes [BR:syb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TZ53_20990
Transporters [BR:syb02000]
 Other Transporters
  Pores ion channels [TC:1]
   TZ53_20990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AJR25851
UniProt: A0A0C5XM39
LinkDB All DBs
Position
4542934..4543563
Genome map
AA seq 209 aa AA seqDB search
MSNEITLYTNPMSRGQIARWMLEEVGEPYDMVVLDYDVGMKSADYLAINPMGKVPAIVHA
GKVVTECAAICAYLADAFPAAGLAPATDGRADYYRWLFFAAGPVEAAITNKALGFAVPEG
RERLAGYGTFDHAIDALERAVSGPAWICGDRFTAADVYVGAQVDWGLSFGSIPSRPVFEA
YAARLRERPAYKRQKELDNALIAKMQKPA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaaatcaccctctacaccaatccgatgtcgcgcgggcagatcgcccgctgg
atgctggaggaagtgggagagccctacgacatggtcgtgctggattatgacgtcggcatg
aagtcggccgattacctcgcgatcaacccgatgggcaaggttcccgccatcgtccacgca
ggcaaggtggtgaccgaatgcgccgccatctgcgcctatctggccgatgcctttcccgcc
gccggcctggcgcccgccaccgatggtcgcgccgactattatcgctggctcttcttcgcc
gccggcccggtggaggccgccatcaccaacaaggcgctcggttttgccgttcccgaaggc
cgcgagcgtctggccggctatggcacgttcgaccatgcgatcgatgccctggaacgcgcc
gtctccggaccagcctggatttgcggcgaccggttcaccgccgccgacgtctatgtggga
gcgcaggtcgattggggcctcagcttcggttcgatccccagccgccccgtcttcgaagcc
tatgcggcgcgcctgcgcgagcgcccggcctataagcggcaaaaggaactggacaacgcc
ctgatcgcaaagatgcagaagcccgcctga

DBGET integrated database retrieval system