KEGG   Synechococcus elongatus PCC6301: syc0129_cHelp
Entry
syc0129_c         CDS       T00163                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00630  Glyoxylate and dicarboxylate metabolism
syc00710  Carbon fixation in photosynthetic organisms
syc01100  Metabolic pathways
syc01120  Microbial metabolism in diverse environments
syc01200  Carbon metabolism
Module
syc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    syc0129_c (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    syc0129_c (rbcS)
Enzymes [BR:syc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     syc0129_c (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAD78319
CyanoBase: syc0129_c
CYORF: syc0129_c
UniProt: P04716
LinkDB All DBs
Structure
PDB: 

Position
complement(139494..139829)
Genome map
AA seq 111 aa AA seqDB search
MSMKTLPKERRFETFSYLPPLSDRQIAAQIEYMIEQGFHPLIEFNEHSNPEEFYWTMWKL
PLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRPGRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaaaactctgcccaaagagcgtcgtttcgagactttctcgtacctgcctccc
ctcagcgatcgccaaatcgctgcacaaatcgagtacatgatcgagcaaggcttccacccc
ttgatcgagttcaacgagcactcgaatccggaagagttctactggacgatgtggaagctc
cccctgtttgactgcaagagccctcagcaagtcctcgatgaagtgcgtgagtgccgcagc
gaatacggtgattgctacatccgtgtcgctggcttcgacaacatcaagcagtgccaaacc
gtgagcttcatcgttcatcgtcccggccgctactaa

DBGET integrated database retrieval system