KEGG   Synechococcus elongatus PCC6301: syc0130_cHelp
Entry
syc0130_c         CDS       T00163                                 

Gene name
rbcL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00630  Glyoxylate and dicarboxylate metabolism
syc00710  Carbon fixation in photosynthetic organisms
syc01100  Metabolic pathways
syc01120  Microbial metabolism in diverse environments
syc01200  Carbon metabolism
Module
syc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    syc0130_c (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    syc0130_c (rbcL)
Enzymes [BR:syc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     syc0130_c (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAD78320
CyanoBase: syc0130_c
CYORF: syc0130_c
UniProt: P00880
LinkDB All DBs
Structure
PDB: 

Position
complement(139920..141338)
Genome map
AA seq 472 aa AA seqDB search
MPKTQSAAGYKAGVKDYKLTYYTPDYTPKDTDLLAAFRFSPQPGVPADEAGAAIAAESST
GTWTTVWTDLLTDMDRYKGKCYHIEPVQGEENSYFAFIAYPLDLFEEGSVTNILTSIVGN
VFGFKAIRSLRLEDIRFPVALVKTFQGPPHGIQVERDLLNKYGRPMLGCTIKPKLGLSAK
NYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKSQAETGEIKGHYLNVT
APTCEEMMKRAEFAKELGMPIIMHDFLTAGFTANTTLAKWCRDNGVLLHIHRAMHAVIDR
QRNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGDKASTLGFVDLMREDHIEADRSRGVF
FTQDWASMPGVLPVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATANRVA
LEACVQARNEGRDLYREGGDILREAGKWSPELAAALDLWKEIKFEFETMDKL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagacgcaatctgccgcaggctataaggccggggtgaaggactacaaactcacc
tattacacccccgattacacccccaaagacactgacctgctggcggctttccgcttcagc
cctcagccgggtgtccctgctgacgaagctggtgcggcgatcgcggctgaatcttcgacc
ggtacctggaccaccgtgtggaccgacttgctgaccgacatggatcggtacaaaggcaag
tgctaccacatcgagccggtgcaaggcgaagagaactcctactttgcgttcatcgcttac
ccgctcgacctgtttgaagaagggtcggtcaccaacatcctgacctcgatcgtcggtaac
gtgtttggcttcaaagctatccgttcgctgcgtctggaagacatccgcttccccgtcgcc
ttggtcaaaaccttccaaggtcctccccacggtatccaagtcgagcgcgacctgctgaac
aagtacggccgtccgatgctgggttgcacgatcaaaccaaaactcggtctgtcggcgaaa
aactacggtcgtgccgtctacgaatgtctgcgcggcggtctggacttcaccaaagacgac
gaaaacatcaactcgcagccgttccaacgctggcgcgatcgcttcctgtttgtggctgat
gcaatccacaaatcgcaagcagaaaccggtgaaatcaaaggtcactacctgaacgtgacc
gcgccgacctgcgaagaaatgatgaaacgggctgagttcgctaaagaactcggcatgccg
atcatcatgcatgacttcttgacggctggtttcaccgccaacaccaccttggcaaaatgg
tgccgcgacaacggcgtcctgctgcacatccaccgtgcaatgcacgcggtgatcgaccgt
cagcgtaaccacgggattcacttccgtgtcttggccaagtgtttgcgtctgtccggtggt
gaccacctccactccggcaccgtcgtcggcaaactggaaggcgacaaagcttcgaccttg
ggctttgttgacttgatgcgcgaagaccacatcgaagctgaccgcagccgtggggtcttc
ttcacccaagattgggcgtcgatgccgggcgtgctgccggttgcttccggtggtatccac
gtgtggcacatgcccgcactggtggaaatcttcggtgatgactccgttctccagttcggt
ggcggcaccttgggtcacccctggggtaatgctcctggtgcaaccgcgaaccgtgttgcc
ttggaagcttgcgtccaagctcggaacgaaggtcgcgacctctaccgtgaaggcggcgac
atccttcgtgaagctggcaagtggtcgcctgaactggctgctgccctcgacctctggaaa
gagatcaagttcgaattcgaaacgatggacaagctctaa

DBGET integrated database retrieval system