KEGG   Synechococcus elongatus PCC6301: syc0481_cHelp
Entry
syc0481_c         CDS       T00163                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00010  Glycolysis / Gluconeogenesis
syc00020  Citrate cycle (TCA cycle)
syc00620  Pyruvate metabolism
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01130  Biosynthesis of antibiotics
syc01200  Carbon metabolism
Module
syc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc0481_c (pdhC)
   00020 Citrate cycle (TCA cycle)
    syc0481_c (pdhC)
   00620 Pyruvate metabolism
    syc0481_c (pdhC)
Enzymes [BR:syc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     syc0481_c (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Motif
Other DBs
NCBI-ProteinID: BAD78671
CyanoBase: syc0481_c
CYORF: syc0481_c
UniProt: A0A0H3K0D2
LinkDB All DBs
Position
complement(540031..541326)
Genome map
AA seq 431 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVEWVKAPGDRVEKGETVLIVESDKADMDVESFYEGYLATII
VPAGGNAPVGEAIALIAETEAEIEVAKQQAAGAGSAAATPATPAATAAPEPVAVSPEPVA
APTATRSDRLVASPRAKKLAKSLGVDLGSLTGSGPHGRIVAADVEAAAGVTAKPAIATPV
APAVVTAPVAAPVATAPAAPAPTPAIAPGQFVPYSTFQQAVVRNMEASLNVPVYRVGYTI
TTDAIDSLAKQLKPKGVTITVLLAKAVAATLAKHPLLNARVTETGVQYNEAINVAIAVAM
DDGGLLTPVLGRADQTDLYSLARNWKDLVARSRTKQLKPEEYTTGTFTLSNLGMFGVDRF
DAILPPGTGAILAIGASKPTLVATADGLFGVKRQMQVNLTCDHRHIYGAHAAAFLKDLAD
LIENRPESLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaagtcttcatgcccgccctcagctccactatgaccgagggcaagatcgtc
gagtgggtgaaggctccgggcgatcgtgtcgagaaaggtgaaacagtcctgatcgtcgag
tcggacaaagccgacatggacgtggaatctttctatgaaggctacctcgcgacgattatt
gtgccggcaggcggcaatgctcccgtgggcgaagcgatcgctctgattgcagaaactgaa
gccgaaattgaagttgcgaagcaacaggcagccggtgctggttccgctgcagcgacccct
gcaacccctgctgctacggcggcacccgaacccgtcgctgtgagccctgaacctgtcgct
gctcctacagcaacccgcagcgatcgcttggttgcctccccgcgtgccaaaaaactcgcc
aagagcttgggcgttgacctcggtagccttaccggcagtggtccccacggtcgaattgtg
gcagccgatgtcgaagccgccgcaggagttactgccaaacccgcgatcgctacccctgtg
gctcctgccgttgtcaccgcaccggttgctgctcccgttgctacggctcctgctgccccc
gcgccaactcccgcgatcgcgccgggtcagttcgtgccctacagcaccttccagcaggcc
gtggttcgcaacatggaagcgagcctcaacgtgccggtctaccgcgtcggttacacgatc
accaccgatgcgatcgatagtttggccaagcagctcaagcccaaaggcgtgacaatcacg
gttttgctggccaaagccgtcgctgcaaccctcgccaagcatcccttgctcaatgctcgg
gtgacagaaactggcgtccagtacaacgaagccatcaacgtggcgatcgcggtggctatg
gatgatggcggtctgctgacccccgtactgggtcgtgctgatcaaaccgatctctatagc
ttggctcgcaactggaaggatctcgtggcgcgatcgcgcaccaagcaactcaaacccgag
gaatacaccaccggcacctttaccctctccaatctagggatgtttggtgtcgatcgcttc
gatgcgattctgccgccgggcaccggtgcgattctggcgattggggcttccaaaccgacc
ctcgtggccacggctgacggtctgtttggcgtcaagcggcagatgcaagttaacctcacc
tgtgatcaccgccacatctacggcgctcatgcggctgccttcctcaaggacttggccgac
ctgattgaaaaccgccccgaaagcctgaccctctaa

DBGET integrated database retrieval system