KEGG   Synechococcus elongatus PCC6301: syc0737_cHelp
Entry
syc0737_c         CDS       T00163                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syc  Synechococcus elongatus PCC6301
Brite
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     syc0737_c (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: BAD78927
CyanoBase: syc0737_c
CYORF: syc0737_c
UniProt: A0A0H3K1N4
LinkDB All DBs
Position
complement(825058..825747)
Genome map
AA seq 229 aa AA seqDB search
MLQETLRRGKRPVFINLGKDNLLKGTHCVSYELPALPFDYTALAPYITKETLEFHHDKHH
AAYINNYNNAVEDTDLDGQPIEAVIKAIAGDASKAGLFNNAAQAWNHSFYWNSIKPNGGG
APTGALADKIAADFGSFENFVTEFKQAAATQFGSGWAWLVLDNGTLKITKTGNADTPIAH
GQTPLLTIDVWEHAYYLDYQNRRPDYISTFVEKLANWDFASANYAAAIA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcaggagacgctcagacgagggaagcgtccggtttttattaatctaggtaaagac
aacctgctcaagggaacacactgcgtgtcctacgaattgccagcattgccctttgactac
acggcactggcgccttacatcaccaaggaaacgctggagttccaccacgataagcaccac
gcggcctacatcaataactacaacaacgccgtcgaagacaccgacctcgatggccagccg
atcgaagccgtgatcaaagcgatcgcgggtgacgctagcaaagccggtctgttcaacaat
gcggctcaagcttggaaccacagcttttactggaactcgatcaagcccaatggcggtggc
gctcccaccggcgcgttggccgacaaaatcgccgctgacttcggcagtttcgagaacttc
gtgaccgagttcaaacaagccgcagcaacccagttcggcagcggctgggcttggttggtg
ctggacaatggcaccctcaaaatcaccaaaaccggcaacgccgacaccccgattgcccat
ggtcaaaccccgctactgaccatcgatgtctgggaacacgcttactacctcgactaccaa
aaccgtcgtcccgactacatcagcaccttcgttgagaagctggcgaactgggacttcgcc
tctgccaactacgcagctgcgatcgcttag

DBGET integrated database retrieval system