KEGG   Synechococcus elongatus PCC6301: syc1030_dHelp
Entry
syc1030_d         CDS       T00163                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00010  Glycolysis / Gluconeogenesis
syc00053  Ascorbate and aldarate metabolism
syc00071  Fatty acid degradation
syc00280  Valine, leucine and isoleucine degradation
syc00330  Arginine and proline metabolism
syc00340  Histidine metabolism
syc00380  Tryptophan metabolism
syc00410  beta-Alanine metabolism
syc00561  Glycerolipid metabolism
syc00620  Pyruvate metabolism
syc00625  Chloroalkane and chloroalkene degradation
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc1030_d
   00053 Ascorbate and aldarate metabolism
    syc1030_d
   00620 Pyruvate metabolism
    syc1030_d
  Lipid metabolism
   00071 Fatty acid degradation
    syc1030_d
   00561 Glycerolipid metabolism
    syc1030_d
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    syc1030_d
   00310 Lysine degradation
    syc1030_d
   00330 Arginine and proline metabolism
    syc1030_d
   00340 Histidine metabolism
    syc1030_d
   00380 Tryptophan metabolism
    syc1030_d
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    syc1030_d
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    syc1030_d
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    syc1030_d
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     syc1030_d
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAD79220
CyanoBase: syc1030_d
CYORF: syc1030_d
UniProt: A0A0H3K534
LinkDB All DBs
Position
1143836..1145215
Genome map
AA seq 459 aa AA seqDB search
MTAVVLPAAAETLAALQATFDRGDTRTLAFRLARLQDLAKLVADNEAELLQALASDLRKP
ALEAYASEIYFVRDQIKLTCKHLRRWMQPEKQSISLMQQPGQAYRQAEPLGVVLIIGPWN
YPFQLLITPLIGAIAAGNCAVLKPSELAPATSSLIQRLISDRFDPDYIRVLEGDASVSQA
LITQPFDHIFFTGGTAIGRKVMAAAAENLTPVTLELGGKSPCIVDTDIDLDVAARRIAWG
KFFNAGQTCIAPDYLLVQRTVAEPFIEALIDNIQQFYGEDPQQSADYARIVSDRHWQRLN
SLLVDGTIRHGGQVDRSDRYIAPTLITDVNWRDPILQEEIFGPLLPILIYDQLDEAIAQI
RAQPKPLALYLFSRDRQVQERVLAETSAGSVCLNDTILQVGVPDAAFGGVGPSGMGGYHG
KASFETFSHYKLVLKRPFWLDLALRYPPYGDKINLFRKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtcgttctccctgctgccgctgaaacgctggctgctttacaagcaaccttt
gatcggggggatacacgcacgctcgccttccgactggcgcgattacaggatctggccaag
ctagttgctgacaatgaagcggagctattgcaagccttggcgtcagacctccgcaaacca
gcactggaagcctacgccagtgagatttatttcgtgcgcgaccaaatcaaactgacctgc
aagcatctgcggcgctggatgcaacccgagaagcagtcgatttccttgatgcagcagcct
ggccaggcctatcgccaagcagaaccgctcggagtcgtgctgatcattggcccctggaac
tatccctttcagctgctcatcacgccgttgattggggcgatcgcggcgggaaattgtgcc
gtactcaaaccatcggaactggctcccgcgacttccagcctgattcagcgactgatcagc
gatcgctttgaccctgattacatccgcgttttagaaggcgatgctagcgttagccaagcc
ctgattactcagcccttcgatcacatcttcttcactggcggcacggcgatcgggcgaaaa
gtgatggctgctgcggccgaaaacctgacgcccgtcaccctcgagttgggcggtaagtca
ccctgcattgttgataccgatatcgacctcgatgtggccgcccgtcgcatcgcctggggc
aaattcttcaacgccggtcaaacctgcattgcgcctgactatttgttggtgcaacgcacg
gtcgcagagccgttcattgaagcgctgatcgacaacatccagcagttctatggcgaggat
ccgcaacagagtgctgactacgcccgcattgtcagcgatcgccactggcaaaggctaaat
agcctgttggttgatggcacgattcgccatggtggtcaggtggataggagcgatcgctac
atcgcaccgactttaattacggacgtcaactggcgcgatcccatcctgcaagaggagatt
tttgggcccctcttgccgattttgatttacgaccaattggatgaggcgatcgcccaaatt
cgtgcccagcccaagcccctcgcgctctatctattcagccgcgatcgccaagtgcaagag
cgcgtcctagcggaaaccagcgccggtagcgtctgcctcaacgacacgatcctgcaggtc
ggcgtccccgatgctgcttttggtggggtcggccccagcggcatgggcggctatcacggc
aaagccagtttcgaaaccttcagtcactacaagctggtgctcaagcgaccgttttggctc
gatctggccctgcgctatccgccctacggcgacaagatcaacctcttccgcaagctctag

DBGET integrated database retrieval system