KEGG   Synechococcus elongatus PCC6301: syc1699_cHelp
Entry
syc1699_c         CDS       T00163                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00730  Thiamine metabolism
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    syc1699_c
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     syc1699_c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 Pyr_redox NAD_binding_8 3HCDH_N NAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: BAD79889
CyanoBase: syc1699_c
CYORF: syc1699_c
UniProt: A0A0H3K3K1
LinkDB All DBs
Position
complement(1836837..1837976)
Genome map
AA seq 379 aa AA seqDB search
MAFEVAVFGGGVIGLAIALELRSRGAMVQVYSQNTQAAAGRVAAGMLAPQSEGIEVGPML
DLGLRSRSLYARWTQQLEQLSGQDSGYWPCGILVPLSEAKNRDRYPHPAESPGQWLSAAD
LRDFQPALCSDLIGGWWFSQEGQVDSRRALYPALRAAAIASGVTIHESVALRELSVTGDR
LQSAMTDRGPVQADAYVLATGAWSGDWLQLPVYPVKGQMFSLQADPRLLNHVLFGERVYI
VPRRDGLIVVGATMEATAGFRTGNTAGPLQSLMAEAIALVPALADCPLVETWWGYRPATP
DEWPILGQGPAENLFLATGHYRNGMLLAPITAQLLADQILDHCTDQLLHAFRYDRFSSHD
SSTHQPLPALAGLSASTGQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgaggtagccgtctttgggggcggcgtcattggcttggcgatcgcgctagaa
ctgcgatcgcgaggcgcgatggtgcaggtctacagtcaaaacactcaggcggcggcaggt
cgtgtggcagcagggatgttggcgccccagtcggaaggcatcgaagtcgggcccatgctg
gatctggggctgcgcagccgatcgctctacgcccgctggacccagcaactcgaacaactc
agcggtcaagacagtggctactggccctgcggcattttggtgcccctgagtgaggccaaa
aatcgcgatcgctatcctcatccagcagaatctccggggcaatggctctcggcagcggac
ttacgagactttcagcccgcactatgctctgacctaatcggtggctggtggttttcccaa
gaagggcaagttgatagtcgccgtgccctgtatccagcgctgcgagccgccgcgatcgcc
agtggcgtcacgatccatgaaagcgtggcgctgcgggagttatctgtaacaggcgatcgc
ctgcaatccgcgatgaccgatcgcgggccagttcaagctgacgcctacgttctggcaacc
ggcgcttggtccggcgactggctacaactgccggtctatcccgttaaaggccaaatgttc
tcgctgcaagctgacccgcgtttgctgaaccacgttttgtttggtgagcgggtgtatatt
gtgccgcgccgagatggtctgattgtggtcggtgccaccatggaagcgacggcgggattc
aggactggcaacaccgctggccccttacagagcttgatggccgaggcgatcgccctcgtt
ccggctctggcggactgtccactggttgaaacttggtggggataccgtcccgcgacacca
gatgaatggccgatcctggggcaaggccccgctgagaacttattcttggcgaccggccac
taccgcaacggtatgctgctcgccccaattaccgctcagctactcgctgaccaaattctc
gaccactgcacggatcaactgcttcatgccttccgttacgaccgcttctccagccatgac
tccagcacccatcaacccttacccgctcttgcaggcttgtcagcgtcaacgggtcagtga

DBGET integrated database retrieval system