KEGG   Synechococcus elongatus PCC6301: syc1846_dHelp
Entry
syc1846_d         CDS       T00163                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00620  Pyruvate metabolism
syc00680  Methane metabolism
syc00710  Carbon fixation in photosynthetic organisms
syc01100  Metabolic pathways
syc01120  Microbial metabolism in diverse environments
syc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    syc1846_d (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    syc1846_d (ppc)
   00680 Methane metabolism
    syc1846_d (ppc)
Enzymes [BR:syc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     syc1846_d (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAD80036
CyanoBase: syc1846_d
CYORF: syc1846_d
UniProt: P06516
LinkDB All DBs
Position
1994940..1998101
Genome map
AA seq 1053 aa AA seqDB search
MLAVSLRDHGFPSATVQIRPAFCVQSDVVGSGNPPRMNYCQNARTAMSAALQSSDDAFRT
VSSPLATDLDLSSPLEFFLRHRLTVVEELWEVVLRQECGQELVDILTQLRDLTSPEGQAP
EVGGEALVQVIETLELSDAIRAARAFALYFQLINIVEQHYEQTQYQLAYERSRLEPLPGP
DESPEGLHTIEIPQHQLDPFAAVIPLNQDPATFQTLFPRLRQLNVPPQMIQELTDRLDIR
LVFTAHPTEIVRHTIRDKQRRIAYLLRQLDELETGKNRGFRELEAQNIRQQLTEEIRLWW
RTDELHQFKPTVLDEVDYALHYFQEVLFEAIPLLYQRFRLALQGTFPDLQPPRYNFCQFG
SWVGSDRDGNPSVTSAVTWQTACYQRSLVLDRYITAVEHLRNVLSLSMHWSEVLPELLSS
LEQESMLFPETYEQLAVRYRQEPYRLKLSYILERLHNTRDRNTRLQQQQEKDPTTPLPEY
RDGTLYQAGTAFLEDLKLIQHNLKQTGLSCYELEKLICQVEIFGFNLVHLDIRQESSRHS
DAINEICEYLQILPQPYNELSEAERTAWLVQELKTRRPLVPARMPFSESTREIIETLRMV
KQLQEEFGEAACQTYIISMSRELSDLLEVLLLAKEVGLYDPVTGKSSLQVIPLFETVEDL
QNAPRVMTALFELPFYTQLNPTQSEPLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALGTV
ARDHRVKLRIFHGRGGSVGRGGGPAYEAILAQPGRTTDGRIKITEQGEVLASKYALPELA
LYNLETITTAVIQSSLLGSGFDDIEPWNQIMEELAARSRRHYRALVYEQPDLVDFFNQVT
PIEEISKLQISSRPARRKTGKRDLGSLRAIPWVFSWTQSRFLLPSWYGVGTALQEFLQER
PEQNLNLLRYFYEKWPFFRMVISKVEMTLAKVDLQIAHHYVHELANPEDQERFERVFSQI
AAEFQLTCHLVLTITNHGRLLDGDPELQRSVQLRNGTIVPLGFLQVALLKRLRQYRQQTE
TTGLMRSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctgtatctctcagggatcacggcttcccgtcagcaactgtccagatccgccct
gcgttctgtgtccagtcagacgtggtgggatcagggaatccacctagaatgaattactgc
cagaacgctcgaactgccatgagtgctgctctccagtcatccgacgatgctttccgaacc
gtttcgagtcccctcgccacggatttggatctgtcgtctccgctggagtttttccttcgc
catcgcttgacggtggttgaagaactctgggaagtggttttgcgccaagagtgcggccaa
gagctggtcgatattctgactcagctgcgtgacttgacctcgccggaaggccaagcccca
gaagtgggcggcgaagccttggttcaggtgattgaaaccctagagttgagcgatgcgatt
cgggctgcccgtgcctttgcgctctactttcagctgatcaatattgttgagcagcactac
gagcaaactcaatatcaactcgcctacgagcgatcgcggttggaacccttgccaggacca
gatgaaagtccggagggattgcacaccattgaaattcctcagcatcagctcgatcccttt
gctgcggtgattccgctcaaccaagatccggcaaccttccaaacgctgttcccgcgcctg
cgccagctcaatgtgccgccgcaaatgatccaagagctgaccgatcgcctcgatattcgg
ctggttttcaccgctcacccgacggaaattgtccgccacacgattcgcgacaaacaacgc
cgaattgcctacctgctgcggcaactggatgagctcgaaacaggcaaaaaccgaggcttt
cgagagcttgaagcgcagaatattcgtcagcagctgaccgaggagattcggctctggtgg
cggacggatgagctccaccagttcaagccaacggtgttggatgaggtggactacgcgctc
cactacttccaagaagtcctctttgaggccattcctctgctctatcagcgctttcggctc
gcgctgcaggggactttccccgacctacaaccgccccgctacaacttctgccagttcggc
tcttgggtcggctccgatcgcgatggcaatccttcagtgacctctgccgtcacttggcaa
accgcttgctatcagcgcagtctcgtcctcgatcgctacatcacagcggttgaacatctc
cgcaatgtgctcagcctctcgatgcactggagcgaggtgctgccggagttgctcagctcg
ttggaacaggagagcatgctcttcccggagacctatgagcagctagcggtccgctatcgc
caagagccctatcgcctcaagctctcctatattctggagcgcctgcacaacacccgcgat
cgcaatacccgcctccaacagcagcaagaaaaagatcccaccacgcccctgcccgaatat
cgggatggcaccctctaccaggctggtacggcctttctcgaagatctcaagctgattcag
cacaaccttaagcagacgggactgagctgttacgagctagagaagttgatctgccaggtc
gagatctttggtttcaacctggtccatctcgacattcgccaagaaagctcgcgccattcc
gacgcgatcaacgaaatctgtgaatacctccaaattcttccccagccctacaacgagctg
agcgaagcagaacgaactgcctggctggttcaagagctgaaaacccgtcggccgctggta
ccagcgcgcatgccgttctcagaatcgacccgcgagatcattgaaaccctgcggatggtc
aagcagctacaggaagaatttggggaggcggcttgccaaacctacatcatcagcatgagc
cgcgagctgagcgacctgctggaagtgctgctgctggccaaggaggttggtctctacgac
ccagtcaccggcaagagttcgcttcaggtgattccgctgtttgaaactgtggaggactta
caaaatgccccgcgggtgatgacggcgctgtttgagctgcccttctacacccagctcaac
cccacccagtctgaaccgctgcaggaagtgatgctggggtattccgacagtaacaaggac
tcgggcttcctcagcagtaactgggagatccacaaggcccagaaagccctagggacggta
gcccgcgaccaccgcgtcaagctgcggatcttccacggccgcgggggctccgtcggtcga
ggtggtggccctgcctacgaggcgatcttggcccagccgggtcgcaccacagatggccga
atcaagattacggaacagggcgaggtcttggcttcgaaatacgccctgcccgaactggcg
ctctataaccttgagacgatcacgacggcggtgattcagtccagcctgctgggtagcggc
tttgatgacattgagccgtggaaccaaattatggaagagttggcggcgcgatcgcggcga
cattaccgcgctttggtgtacgagcagcccgacctggttgacttcttcaatcaggtaacg
ccgattgaggagatcagcaaactgcaaatcagctcgcgaccggctcgacgcaaaaccggc
aagcgcgatctgggcagtctacgtgccatcccctgggtctttagctggacgcagagtcgt
tttctgctgccctcttggtatggcgtcggcacagcacttcaggagtttttgcaggagcgc
ccggagcagaacctcaacctgctgcgctacttctacgagaagtggccgttcttccgcatg
gtgatctcgaaggtcgagatgaccctagcgaaggtcgatttgcagattgctcatcactac
gtgcatgagctggccaatcctgaggatcaagagcggtttgaacgagtgttcagccaaatc
gctgcagagtttcagctgacttgtcatctcgtgttgacgattaccaaccacggtcgcttg
ctggatggcgaccccgaactgcagcgatcggtgcagctgcgcaacggtacgatcgtgccc
ctcggcttcttgcaagtcgccctgcttaaacgcctgcggcagtatcgccagcaaacggaa
acgacgggattgatgcgatcgcgctatagcaaaggggaactgctgcgcggagcattgctg
acgatcaacggcattgcggctggcatgcgcaatacaggttga

DBGET integrated database retrieval system