KEGG   Synechococcus sp. CC9605: Syncc9605_0752Help
Entry
Syncc9605_0752    CDS       T00292                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00630  Glyoxylate and dicarboxylate metabolism
syd00710  Carbon fixation in photosynthetic organisms
syd01100  Metabolic pathways
syd01120  Microbial metabolism in diverse environments
syd01200  Carbon metabolism
Module
syd_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syd_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Syncc9605_0752
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9605_0752
Enzymes [BR:syd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Syncc9605_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABB34521
CyanoBase: Syncc9605_0752
CYORF: Syncc9605_0752
UniProt: Q3ALL1
LinkDB All DBs
Position
716826..718241
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKSCYGPPNGIQVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLSEQETGERKGHYLNVTANTPE
EMYERAEFAKELGMPIIMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVTIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGRHLEKESRDILTEAAKHSPELAIALETWKEIKFEFDTVDKLDVQN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagggatacctactggactcctgat
tacgtccccctcgacaccgacctgctggcctgcttcaagtgcaccggccaagaaggtgtg
cccaaggaagaagttgccgctgctgtggctgctgaatcctccaccggcacctggtccact
gtgtggtccgagctccttaccgatctcgacttctacaaaggccgttgctaccgcatcgaa
gacgtccctggtgacaaggagtctttctatgccttcatcgcctaccccctcgacctgttc
gaagagggttccattaccaacgttctgacctccctggtcggcaatgtgttcggtttcaag
gctctgcgccacctccgtctggaagacatccgcttcccgatggcgttcatcaagagctgc
tacggcccgccgaacggcatccaggtcgagcgcgaccggatgaacaagtatggccgtcct
ttgcttggttgcaccatcaagccgaagctcggcctgagcggtaagaactacggccgtgtt
gtctatgaatgcctgcgtggcggtctggacttcaccaaggacgacgagaacatcaactcc
cagcccttccagcgttggcagaaccgcttcgaattcgttgcggaagccatcaagctgtcc
gagcaggagaccggcgagcgcaagggtcactacctcaacgtgactgccaacactcccgag
gagatgtacgagcgcgctgagttcgccaaggaactcggcatgccgatcatcatgcacgac
ttcatcaccggtggcttcacggccaacaccggtctgtcgaagtggtgccgcaagaacggc
atgttgctgcacatccaccgcgccatgcacgcagtgatcgaccgtcaccccaagcacggc
atccacttccgcgttctcgccaagtgtctgcgtctgtccggtggtgaccagctccacacc
ggcaccgtggtcggcaagctggaaggtgatcgtcagaccaccctcggctacatcgaccag
ctgcgcgaatccttcgtgcccgaagaccgcagccgcggcaacttctttgatcaggactgg
ggttccatgcctggcgtgttcgccgttgcttccggcggtatccacgtgtggcacatgccc
gccctggtcaccatcttcggcgacgactccgttcttcagttcggtggtggtacccacggt
cacccctggggctccgctgcaggtgctgctgccaaccgtgtggccctcgaggcctgcgtc
aaggcacgcaacgccggccgtcatctcgagaaagagagccgcgacatcctcacggaagcc
gcgaagcacagccctgagctggccatcgccctcgagacctggaaggagatcaagttcgag
ttcgacaccgtcgacaagctcgacgtccagaactga

DBGET integrated database retrieval system