KEGG   Synechococcus sp. CC9605: Syncc9605_0753Help
Entry
Syncc9605_0753    CDS       T00292                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00630  Glyoxylate and dicarboxylate metabolism
syd00710  Carbon fixation in photosynthetic organisms
syd01100  Metabolic pathways
syd01120  Microbial metabolism in diverse environments
syd01200  Carbon metabolism
Module
syd_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syd_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Syncc9605_0753
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9605_0753
Enzymes [BR:syd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Syncc9605_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABB34522
CyanoBase: Syncc9605_0753
CYORF: Syncc9605_0753
UniProt: Q3ALL0
LinkDB All DBs
Position
718301..718642
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLVEHVHPSNCMATYWS
YWKLPFFGEKDLNVVVSELEACHRAYPDHHVRIVGYDAYTQSQGACFVVFEGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcaccgtgggtgactatcaaacagtcgccaccctggagaccttcggc
ttcctcccgccgatgacccaggacgagatctacgaccagatcgcctacatcattgcccag
ggttggagcccgctcgttgagcacgtccaccccagcaactgcatggccacctactggtcg
tattggaagctccccttcttcggtgagaaggatctgaacgtcgttgtcagtgagctcgag
gcttgccaccgcgcataccccgaccatcacgtgcgcatcgtcggttacgacgcctacacc
cagagccagggtgcctgcttcgtggttttcgaaggacgctga

DBGET integrated database retrieval system