KEGG   Synechococcus sp. CC9605: Syncc9605_2009
Entry
Syncc9605_2009    CDS       T00292                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase component (E2) of pyruvate
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00010  Glycolysis / Gluconeogenesis
syd00020  Citrate cycle (TCA cycle)
syd00620  Pyruvate metabolism
syd01100  Metabolic pathways
syd01110  Biosynthesis of secondary metabolites
syd01120  Microbial metabolism in diverse environments
syd01200  Carbon metabolism
Module
syd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9605_2009
   00020 Citrate cycle (TCA cycle)
    Syncc9605_2009
   00620 Pyruvate metabolism
    Syncc9605_2009
Enzymes [BR:syd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syncc9605_2009
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: ABB35750
CyanoBase: Syncc9605_2009
CYORF: Syncc9605_2009
UniProt: Q3AI32
LinkDB
Position
complement(1828840..1830171)
AA seq 443 aa
MATTDIFMPALSSTMTEGKIVEWLKQPGDKVARGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQAKAPTAPAAAAAPAPAPAPAPTPAAVQAPAPT
PAPAPAPVAAPAPSAPVVNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQAEDVEQA
SGQPISVPRVAEGTAPAASAAGAAAAAAPAAPAGNSFGRPGETVAFNTLQGAVNKNMEAS
LAVPCFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTVAGMAY
PVDVNVAVAVAMEDGGLITPVLRNADRTDLYEMSRQWGDLVKRSRSKQLQPEEYSTGTFT
LSNLGMFGVDRFDAILPPGTGAILAVAASRPKVVANKDGSIAVKRQMQVNLTADHRVIYG
ADGAAFLKDLADLIENRPESLAL
NT seq 1332 nt   +upstreamnt  +downstreamnt
ttggcgaccacagacatcttcatgcctgccctcagctccaccatgacggaggggaagatc
gtggagtggctgaaacagcccggagacaaggtggctcgtggggagtcggttcttgtcgtt
gagtccgacaaagcggacatggacgttgagtcattccaggacggctacctggctgcggtg
ttgatgcctgctggcagcacggcaccggtgggcgaaaccatcggtctgattgtcgaaacc
gaagctgagatcgccgacgcgcaggccaaggcccccaccgctcccgcggcggctgcagct
cccgcccctgcaccggctccggctccaacaccagctgcggtccaggccccagccccaacc
cctgcgccggctccggcacctgttgctgcccctgcaccgtcggcaccggtggtgaatgac
ggccgcatcgtggccagcccccgggcgaagaagctggcctcccagatgggtgtggacctg
gccaccgtgcgtggcagcggtccccatggccggattcaggcggaagacgttgagcaagcc
tccggtcagcccatctccgtgcctcgggtggcggaaggaacggctcccgctgcttccgcg
gctggggctgcagcagcagcagccccggcggctccggcgggcaacagctttggtcgcccc
ggcgagaccgtggcgttcaacacccttcagggtgcggtgaacaaaaacatggaggcgagc
ctggcggttccctgcttccgcgttggttacaccatcaccaccgacaagctggatgccttc
tacaaacaggtgaagcccaagggcgtcacgatgacggcactgctggccaaggcggtggcc
gtcaccctggcgcgtcatccccaggtgaatgccgccaccactgtcgctggcatggcctac
ccggtcgatgtgaacgtggctgtcgctgtggcgatggaagacggtggcttgatcacgccg
gtgctgcgcaatgccgaccgtaccgatctctatgagatgtcgcgtcagtggggtgatctg
gtcaagcgctcccgcagcaagcagctgcagccggaggaatattccacgggcaccttcacc
ctttccaacctcggcatgttcggtgttgatcgcttcgacgcgatccttcccccaggcacc
ggagccattctggccgtcgccgcatcacgcccaaaagtggtggcaaacaaggacgggtcc
atcgccgtcaagcgtcagatgcaggtcaacctgacggcggatcaccgggtgatttacggc
gctgacggcgctgcattcctgaaggatctcgccgatctgatcgagaaccgtccagaaagc
ttggcgctctga

DBGET integrated database retrieval system