KEGG   Synechococcus sp. CC9605: Syncc9605_2171Help
Entry
Syncc9605_2171    CDS       T00292                                 

Definition
(GenBank) ATP synthase F1, beta subunit
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00190  Oxidative phosphorylation
syd00195  Photosynthesis
syd01100  Metabolic pathways
Module
syd_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:syd00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Syncc9605_2171
   00195 Photosynthesis
    Syncc9605_2171
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syd00194]
    Syncc9605_2171
Enzymes [BR:syd01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     Syncc9605_2171
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     Syncc9605_2171
Photosynthesis proteins [BR:syd00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Syncc9605_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ATPase RsgA_GTPase AAA ATPase_2 ABC_tran AAA_16 NACHT T3SS_ATPase_C RNA_helicase NB-ARC AAA_19 AAA_7 TrwB_AAD_bind NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABB35910
CyanoBase: Syncc9605_2171
CYORF: Syncc9605_2171
UniProt: Q3AHM2
LinkDB All DBs
Position
1987327..1988790
Genome map
AA seq 487 aa AA seqDB search
MVASAPASAGTKGVIRQVIGPVLDVEFPAGKLPKIYNALRIEGKNPAGDDVALTAEVQQL
LGDHRVRAVAMSGTDGLVRGMEAVDTGAPISVPVGEGTLGRIFNVLGEPVDEQGPVNTTA
TAPIHRDAPNITELETKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINN
IAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINADDLSKSKVALCYGQMNEPPGARMR
VGLSALTMAEHFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGA
LQERVASTVEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLNRALASKGIYPAVDPL
DSTSTMLQPAVVGDEHYRTARAVQSTLQRYKELQDIIAILGLDELSEDDRRTVDRARKVE
KFLSQPFFVAEIFTGMPGKYVKLEETIAGFNQILAGELDSLPEAAFYLVGNIEEVKAKAE
KIAAETK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcttctgctcctgcatctgctggcaccaagggtgtgatccgtcaggtgatcggc
ccggttctggacgttgaattccccgccgggaaactgcccaagatctataacgctcttcgc
atcgaggggaaaaaccccgcgggcgatgacgtcgccctgaccgctgaggttcaacagctt
ctgggggatcaccgggttcgcgccgttgccatgagtggcaccgacggtctggtccgcggc
atggaagccgttgacaccggtgcaccgatttccgtgcctgtgggtgaaggcaccctcggc
cgtatcttcaacgtgctgggcgagcccgtcgacgagcagggacccgtcaacaccacggcc
accgctcccatccaccgggatgcccccaacatcaccgagcttgagaccaagcccaaggtg
ttcgagaccggcatcaaggtgatcgacctgctggctccctatcgccaggggggcaaggtc
ggcctgttcggcggcgccggcgtgggcaagaccgtgttgattcaggagctgatcaacaac
atcgccaaggagcacggcggtgtgtccgtgttcggtggtgtgggtgagcgcacccgtgag
ggcaacgatctctacgaggaattcaaggagtccggcgtgatcaacgccgacgacctttcc
aagtcgaaggtggccctgtgctacggccagatgaacgagccccccggtgcccgcatgcgc
gttggtctctccgctctgaccatggcggagcacttccgcgacgtgaacaagcaggacgtt
ctgctgttcgtggataacatcttccgcttcgtgcaggccggttccgaggtgtccgcactt
ctgggccgcatgccttccgctgtgggctaccagcccaccctgggcaccgacgtgggtgca
ctgcaggagcgtgttgcttccaccgttgaaggttcgatcacctcgatccaggccgtttac
gtgcctgctgacgacctgaccgaccctgctccggccaccacctttgctcacctcgacgcc
accacggtgctgaaccgtgccctggcctccaagggcatctaccccgctgtggatccactc
gattccaccagcaccatgcttcagccagccgtggtgggtgacgagcactaccgcaccgcc
cgtgccgtgcagtccaccctgcagcgctacaaggaactgcaggacatcatcgcgattctg
ggtctcgacgaactgtcggaagacgaccgtcgcaccgtggatcgtgcccgcaaggtagag
aagttcctctcccagcctttcttcgtggccgagatcttcaccggcatgcccggcaagtac
gtgaagctggaggaaaccatcgctggtttcaaccagatccttgccggtgagctggacagc
ctccccgaagctgccttctacctggtgggcaacatcgaggaagtgaaagccaaggccgag
aagatcgccgccgaaaccaagtga

DBGET integrated database retrieval system