KEGG   Synechococcus sp. CC9902: Syncc9902_0662
Entry
Syncc9902_0662    CDS       T00293                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00010  Glycolysis / Gluconeogenesis
sye00020  Citrate cycle (TCA cycle)
sye00620  Pyruvate metabolism
sye01100  Metabolic pathways
sye01110  Biosynthesis of secondary metabolites
sye01120  Microbial metabolism in diverse environments
sye01200  Carbon metabolism
Module
sye_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0662
   00020 Citrate cycle (TCA cycle)
    Syncc9902_0662
   00620 Pyruvate metabolism
    Syncc9902_0662
Enzymes [BR:sye01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syncc9902_0662
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: ABB25630
CyanoBase: Syncc9902_0662
CYORF: Syncc9902_0662
UniProt: Q3AZ47
LinkDB
Position
672042..673388
AA seq 448 aa
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVARGESVLVVESDKADMDVESFQDGFLAAV
LMPAGSTAPVGETIGLIVETEAEIADAKANAPAAPAAAAAPAPTPTPAPTPAAVQASTTS
PAPAPAAPPVVTAPPVVTAPVVNDGRIVASPRAKKLASQMGVDLSTVRGSGPHGRIQAED
VEQATGQPISVPRVAEGTAPAAGGSVTSAAAPAAAAPAGNSFGRPGETVAFNTLQGAVNR
NMEASLAVPCFRVGYTITTDKLDAFYKKVKPKGVTMTALLAKAVAVTLAHHPQVNAATTA
AGMSYPADVNVAVAVAMEDGGLITPVLRQADRTDLYEMSRQWADLVKRSRSKQLLPEEYS
TGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPMVVAGKDGSISVKRQMQVNLTADH
RVVYGADGASFLKALADLIENRPESLAL
NT seq 1347 nt   +upstreamnt  +downstreamnt
ttggcaacccacgacatctttatgcctgcccttagctccaccatgacggagggcaagatc
gtcgagtggctgaaacagcctggtgacaaggtcgcccgcggcgaatcagttctggtggtg
gagtcggataaggccgacatggacgttgagtcgtttcaggatggctttctggccgcggtt
ctgatgccggctggcagcacggcaccggtgggagaaaccatcggtttgatcgttgaaacc
gaggccgagattgcagacgccaaagccaatgctccagcagctccagcggctgcggcagcc
cctgcacccacacccacgccagctcctacaccagcagcggtccaagcatcaacgacgtct
cccgctccagcccccgctgccccccctgtggtgacagcgccccctgtggtgacagccccc
gttgtgaatgacggtcgcatcgtcgccagcccccgggccaaaaagcttgcctcccaaatg
ggtgtcgacctctccacggttcgtggcagtggcccccacgggcgaatccaggccgaagat
gtggaacaggccaccgggcagcccatttcagtgccgcgggtggcggaagggacggctccc
gcggctggaggatctgtcacctcagccgcagcaccggcagcagctgccccggctggtaat
agctttggccgtcccggtgagacggttgcgttcaacaccctgcagggggctgtgaaccgc
aacatggaagccagccttgctgtgccttgcttccgcgttggttacacgatcaccaccgac
aaattggatgcgttttacaaaaaggtgaagccaaagggcgtcacgatgacggcccttttg
gccaaggcagtggccgtgacgctggcccatcatccccaggtgaatgcggcaactaccgca
gctgggatgagttatcccgctgatgtgaatgtggctgtcgctgtcgcgatggaagacggg
ggcttaattacgcctgttttgcgtcaagccgaccgcactgatctctatgagatgtctcgc
caatgggccgaccttgtgaagcgatcccgtagtaagcagcttttgcctgaggaatacagc
acgggaacgttcaccctctccaatttgggcatgtttggcgtcgaccgcttcgatgcgatc
cttcccccaggcactggagcgattttggccgtggccgcatcccgtccgatggtggtggct
ggcaaggatggctccatttcggtgaaacgtcagatgcaggtgaacctcaccgctgatcat
cgggttgtctacggcgccgatggtgcttccttcctcaaggccctggctgatttgattgag
aaccgtccggagagcttggcgctctga

DBGET integrated database retrieval system