KEGG   Synechococcus sp. CC9902: Syncc9902_1541Help
Entry
Syncc9902_1541    CDS       T00293                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00473  D-Alanine metabolism
sye00550  Peptidoglycan biosynthesis
sye01100  Metabolic pathways
sye01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sye00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Syncc9902_1541
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Syncc9902_1541
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Syncc9902_1541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sye01011]
    Syncc9902_1541
Enzymes [BR:sye01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Syncc9902_1541
Peptidoglycan biosynthesis and degradation proteins [BR:sye01011]
 Precursor biosynthesis
  Amino acid ligase
   Syncc9902_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 DUF2625
Motif
Other DBs
NCBI-ProteinID: ABB26499
CyanoBase: Syncc9902_1541
CYORF: Syncc9902_1541
UniProt: Q3AV89
LinkDB All DBs
Position
1491560..1492612
Genome map
AA seq 350 aa AA seqDB search
MESRPTTIGLVFGGYSGEHEVSIRSATTVIHGLRSGENSQRYRVIPFYIDQEGRWWGEAF
ANRVLASQKPIEPPHSIETKGFRELPEGSETVQVWYPVLHGPNGEDGTVQGLFQLMRQPF
VGAGVLGSAVSMDKLAMKAAFAGAGLSQVPYVGLNASDLGDSARREHVLDRIEAELHYPC
FVKPANLGSSVGISKVRNRHELETGLDHAAQLDPRLVVEQGVDARELECAVLGRHQLRSS
VVGEVRFDADWYDYTTKYTAGLSTTVIPAELPEGVAERVQQQALEACAALGVVGMARVDF
FYDNTSHQLWINEINTLPGFTSQSMYPMLWEASGVTLDQLVHKLVQSAGE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcgacccacaacgatcggtcttgtttttggcggctactccggcgagcacgag
gtctccattcggtcagcgaccaccgtcatccatggtctgcgaagcggtgaaaacagtcag
cgctaccgcgtgattccgttctatatcgaccaggaaggtcgctggtggggggaggcgttc
gccaatcgtgtcttggcgagtcaaaagcccatcgagccgcctcattccatcgaaaccaaa
ggatttagagagcttcccgagggcagtgaaaccgttcaggtgtggtacccggttttgcat
ggacccaacggagaagacggaactgttcaaggcttgtttcagctgatgcgtcaacccttt
gttggtgcaggagtccttggatcagcagtgagcatggacaagcttgcgatgaaagcagcg
ttcgctggtgctggcctgtctcaagtgccttacgtcggcctcaatgcttccgatctcggt
gattccgcccggcgtgaacatgttttggatcggatcgaagccgaactgcactacccatgc
tttgtgaagccagcgaatctcggctcgtccgtggggatcagcaaagtgcgcaaccgtcat
gagctggaaacaggcctcgaccatgcggcgcagctcgaccctcggctggtggtggaacag
ggcgttgatgcccgagagctggagtgcgctgttctcgggcgacatcagcttcgatcgtct
gttgttggagaagttcgcttcgacgcggattggtatgactacacaacgaaatacaccgcc
ggactaagtacaacggtgatcccggctgagctaccggaaggtgtcgcagagcgtgttcag
caacaagccctcgaagcctgtgcagcactgggcgttgttggaatggcccgggtggatttt
ttctacgacaacaccagtcatcaactctggatcaatgagatcaataccctgcccggcttc
acaagtcagagcatgtaccccatgctctgggaggccagtggagtaacactcgaccagctc
gtgcacaaactggttcaatcagcaggagaatga

DBGET integrated database retrieval system