KEGG   Synechococcus sp. CC9902: Syncc9902_1614Help
Entry
Syncc9902_1614    CDS       T00293                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00630  Glyoxylate and dicarboxylate metabolism
sye00710  Carbon fixation in photosynthetic organisms
sye01100  Metabolic pathways
sye01120  Microbial metabolism in diverse environments
sye01200  Carbon metabolism
Module
sye_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sye_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sye_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Syncc9902_1614
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_1614
Enzymes [BR:sye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Syncc9902_1614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABB26572
CyanoBase: Syncc9902_1614
CYORF: Syncc9902_1614
UniProt: Q3AWU1
LinkDB All DBs
Position
complement(1563311..1564723)
Genome map
AA seq 470 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKEAFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKCCAGPPNGIAVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLAEQETGERKGHYLNVTANTPE
EMYERAEFAKELNQPIIMHDFITGGFTANTGLSKWCRANGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAGKHSPELAIALETWKEIKFEFDTVDKLDVQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagggacacttactggactcctgat
tacgttcccctagacaccgacctcctggcctgcttcaagtgcaccggccaagaaggtgtt
cccaaggaagaagttgccgctgctgtggctgctgaatcctcaaccggcacctggtccact
gtgtggtccgagctcctcaccgacctcgacttctacaagggccgttgctatcgcatcgaa
gacgttcctggtgacaaggaggcgttctatgccttcatcgcttaccccctcgacctgttc
gaagagggttcgatcaccaacgttctgacctcattggtcggcaacgtgttcggcttcaaa
gctttgcgccacctgcgtctggaagacattcgcttcccgattgcattcatcaagtgctgc
gcaggcccaccaaacggcattgccgttgagcgtgaccgtatgaacaagtacggccgtcca
ctgttgggttgcaccatcaagccaaaacttggcttgagcggcaagaactatggccgtgtt
gtctatgagtgcctgcgtggcggtctggacttcaccaaggacgacgagaacatcaactcc
cagccgttccagcgttggcagaaccgcttcgaattcgttgcggaagccatcaagctggcc
gaacaggagaccggtgagcgcaagggtcactacctcaacgtgaccgccaacactcccgaa
gagatgtatgagcgcgctgagttcgctaaagaactcaatcagccgatcatcatgcacgac
ttcatcaccggtggctttaccgccaacaccggtctgtcgaagtggtgtcgtgcgaacggc
atgctgctgcacattcaccgtgccatgcacgctgtgattgaccgtcatcccaagcacggc
attcacttccgcgttctcgcgaagtgcctgcgtctctccggtggtgaccagcttcacacc
ggcaccgtggtcggcaagttggagggtgatcgtcagaccaccctcggctacatcgaccaa
ctgcgtgaatccttcgttcctgaagaccgcagccgcggcaacttcttcgatcaggactgg
ggttccatgcccggtgtgttcgccgttgcttccggtggtatccacgtgtggcacatgccc
gcactggtggcgatcttcggagacgattccgtcctgcagttcggtggtggtacccacggt
cacccctggggctccgcagctggtgctgctgctaaccgcgttgcccttgaggcctgcgtc
aaggcacgtaacgccggtcgcgagatcgagaaagaaagccgcgacatccttatggaagcc
ggcaagcacagccccgagctggccatcgctctcgagacctggaaggagatcaagttcgag
ttcgacaccgtcgacaagctcgacgtccagtga

DBGET integrated database retrieval system