KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0771Help
Entry
Synpcc7942_0771   CDS       T00300                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Synpcc7942_0771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syf02000]
    Synpcc7942_0771
Enzymes [BR:syf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Synpcc7942_0771
Transporters [BR:syf02000]
 Other Transporters
  Pores ion channels [TC:1]
   Synpcc7942_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_N Glutaredoxin GST_N_4 TniQ
Motif
Other DBs
NCBI-ProteinID: ABB56803
CyanoBase: Synpcc7942_0771
CYORF: Synpcc7942_0771
UniProt: Q31Q66
LinkDB All DBs
Position
complement(763640..764854)
Genome map
AA seq 404 aa AA seqDB search
MSSFALSWSELATLTDFNPDRVNGPTNAQSTLRLFGQPESAVRVTLYRDHHAWCPYCQKV
WLWLEEKQIPYRIAKVTMFCYGEKETWYKRKVPSGMLPALELDGRIITESDDILLALEST
FGPLMHSLLDRTVLPLRRLERELFRAWCGWLCYPSRSPQQDQQGRTAFQAVVDRVEAALA
STPGPYFLECFGVTDVIFTPYVERMNASLFYYKGYSLREINPRLSDWFEAMESRETYRGT
QSDFHTHAHDLPPQMGGCYANTDPQTAVCQARVDQGPWFGLPDVTYPEPPTARQEALQRV
LRHKDTLIRLNPLEAEVFDPALRAALTTLITGQVCPPPAGSDRGLRYLRDRISVPRDMSI
YAAKHLREALEATAQLAGDRQGPAISMRDRRDQDPARFASATAC
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagttcttttgccctcagttggtctgagctggctactttgaccgatttcaaccccgat
cgcgtcaatggccccaccaatgcccagagcaccctacgactgtttgggcagccggagtcg
gcagtgcgcgttaccctctatcgcgatcaccatgcttggtgtccctattgccaaaaggtc
tggctttggctggaggagaaacaaattccctaccgcatcgccaaggtgacgatgttctgc
tacggcgagaaagagacctggtacaagcgcaaagtcccctcggggatgctgccagcatta
gaactcgatggccgaatcattacggaaagcgatgacattctgctggcgctggagtctact
tttggaccactgatgcatagcctgctggatcggaccgttttacccctgcgccgactggag
cgggaactctttcgggcttggtgtggctggctttgctatccctcgcgatcgccccaacag
gatcagcaagggcgcactgcctttcaagcggtagttgatcgtgttgaagcagctctggcg
agtacccccggcccttacttccttgagtgctttggggtgacggatgtgattttcacgccc
tacgtcgagcggatgaacgccagccttttctactacaagggctattccctgcgcgagatc
aacccacgcctcagcgactggtttgaggcgatggaaagccgcgaaacctatcggggcacc
cagagcgacttccatacccacgcccacgatttgccgccgcaaatgggcgggtgctacgcc
aacaccgatccacaaacggcggtatgccaagcccgtgtggatcaaggcccttggtttggg
ttgcccgatgtgacttatcctgagccgcccacggctcgccaagaagccctacaacgggtg
ttgcgccacaaagacacgctaatccgcctgaacccactagaggctgaggtcttcgatccg
gctctccgcgctgcgctcaccacgctaataaccggccaagtttgtccgccaccggctggc
tctgatcgaggactgcgctatctgcgcgatcgcatcagcgtgcctcgtgatatgtcgatc
tatgcggccaaacacttgcgggaagccttggaggcaacagcacaactagcgggcgatcgc
caaggaccagcgatttccatgcgcgatcgccgtgaccaagatcctgcccgctttgccagt
gcaaccgcttgttaa

DBGET integrated database retrieval system