KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0801Help
Entry
Synpcc7942_0801   CDS       T00300                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syf  Synechococcus elongatus PCC7942
Brite
Enzymes [BR:syf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Synpcc7942_0801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: ABB56833
CyanoBase: Synpcc7942_0801
CYORF: Synpcc7942_0801
UniProt: P18655
LinkDB All DBs
Position
795123..795812
Genome map
AA seq 229 aa AA seqDB search
MLQETLRRGKRPVFINLGKDNLLKRTHCMSYELPALPFDYTALAPYITKETLEFHHDKHH
AAYVNNYNNAVKDTDLDGQPIEAVIKAIAGDASKAGLFNNAAQAWNHSFYWNSIKPNGGG
APTGALADKIAADFGSFENFVTEFKQAAATQFGSGWAWLVLDNGTLKITKTGNADTPIAH
GQTPLLTIDVWEHAYYLDYQNRRPDYISTFVEKLANWDFASANYAAAIA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcaggagacgctcagacgagggaagcgtccggtttttattaatctaggtaaagac
aacctgctcaagagaacacactgcatgtcctacgaattgccagcattgccctttgactac
acggcactggcgccttacatcaccaaggaaacgctggagttccaccacgataagcaccac
gcggcctacgtcaataactacaacaacgccgtcaaagacaccgacctcgatggccagccg
atcgaagccgtgatcaaagcgatcgcgggtgacgctagcaaagccggtctgttcaacaat
gcggctcaagcttggaaccacagcttttactggaactcgatcaagcccaatggcggtggc
gctcccaccggcgcgttggccgacaaaatcgccgctgacttcggcagtttcgagaacttc
gtgaccgagttcaaacaagccgcagcaacccagttcggcagcggctgggcttggttggtg
ctggacaatggcaccctcaaaatcaccaaaaccggcaacgccgacaccccgattgcccat
ggtcaaaccccgctactgaccatcgatgtctgggaacacgcttactacctcgactaccaa
aaccgtcgtcccgactacatcagcaccttcgttgagaagctggcgaactgggacttcgcc
tctgccaactacgcagctgcgatcgcttag

DBGET integrated database retrieval system