KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1068Help
Entry
Synpcc7942_1068   CDS       T00300                                 

Definition
(GenBank) pyruvate dehydrogenase dihydrolipoamide acetyltransferase component (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00010  Glycolysis / Gluconeogenesis
syf00020  Citrate cycle (TCA cycle)
syf00620  Pyruvate metabolism
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01120  Microbial metabolism in diverse environments
syf01130  Biosynthesis of antibiotics
syf01200  Carbon metabolism
Module
syf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_1068
   00020 Citrate cycle (TCA cycle)
    Synpcc7942_1068
   00620 Pyruvate metabolism
    Synpcc7942_1068
Enzymes [BR:syf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Synpcc7942_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABB57098
CyanoBase: Synpcc7942_1068
CYORF: Synpcc7942_1068
UniProt: Q31PC1
LinkDB All DBs
Position
1079478..1080773
Genome map
AA seq 431 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVEWVKAPGDRVEKGETVLIVESDKADMDVESFYEGYLATII
VPAGGNAPVGEAIALIAETEAEIEVAKQQAAGAGSAAATPATPAATAAPEPVAVSPEPVA
APTATRSDRLVASPRAKKLAKSLGVDLASLTGSGPHGRIVAADVEAAAGVTAKPAIATPV
APAVVTAPVAAPVATAPAAPAPTPAIAPGQFVPYSTFQQAVVRNMEASLNVPVFRVGYTI
TTDAIDSLAKQLKPKGVTITVLLAKAVAATLAKHPLLNARATETGVQYNEAINVAIAVAM
DDGGLLTPVLGRADQTDLYSLARNWKDLVARSRTKQLKPEEYTTGTFTLSNLGMFGVDRF
DAILPPGTGAILAIGASKPTLVATADGLFGVKRQMQVNLTCDHRHIYGAHAAAFLKDLAD
LIENRPESLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaagtcttcatgcccgccctcagctccactatgaccgagggcaagatcgtc
gagtgggtgaaggctccgggcgatcgtgtcgagaaaggtgaaacagtcctgatcgtcgag
tcggacaaagccgacatggacgtggaatctttctatgaaggctacctcgcgacgattatt
gtgccggcaggcggcaatgctcccgtgggcgaagcgatcgctctgattgcagaaactgaa
gccgaaattgaagttgcgaagcaacaggcagccggtgctggttccgctgcagcgacccct
gcaacccctgctgctacggcggcacccgaacccgtcgctgtgagccctgaacctgtcgct
gctcctacagcaacccgcagcgatcgcttggttgcctccccgcgtgccaaaaaactcgcc
aagagcttgggcgttgacctcgctagccttaccggcagtggtccccacggtcgaattgtg
gcagccgatgtcgaagccgccgcaggagttactgccaaacccgcgatcgctacccctgtg
gctcctgccgttgtcaccgcaccggttgctgctcccgttgctacggctcctgctgccccc
gcgccaactcccgcgatcgcgccgggtcagttcgtgccctacagcaccttccagcaggcc
gtggttcgcaacatggaagcgagcctcaacgtgccggtcttccgcgtcggttacacgatc
accaccgatgcgatcgatagtttggccaagcagctcaagcccaaaggcgtgacaatcacg
gttttgctggccaaagccgtcgctgcaaccctcgccaagcatcccttgctcaatgctcgg
gcgacagaaactggcgtccagtacaacgaagccatcaacgtggcgatcgcggtggctatg
gatgatggcggtctgctgacccccgtactgggtcgtgctgatcaaaccgatctctatagc
ttggctcgcaactggaaggatctcgtggcgcgatcgcgcaccaagcaactcaaacccgag
gaatacaccaccggcacctttaccctctccaatctagggatgtttggtgtcgatcgcttc
gatgcgattctgccgccgggcaccggtgcgattctggcgattggggcttccaaaccgacc
ctcgtggccacggctgacggtctgtttggcgtcaagcggcagatgcaagttaacctcacc
tgtgatcaccgccacatctacggcgctcatgcggctgccttcctcaaggacttggccgac
ctgattgaaaaccgccccgaaagcctgaccctctaa

DBGET integrated database retrieval system