KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1723Help
Entry
Synpcc7942_1723   CDS       T00300                                 

Definition
(GenBank) carotene isomerase
Organism
syf  Synechococcus elongatus PCC7942
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO HI0933_like FAD_oxidored Pyr_redox_2 Thi4 Lycopene_cycl Pyr_redox FAD_binding_3 GIDA UPF0227
Motif
Other DBs
NCBI-ProteinID: ABB57753
CyanoBase: Synpcc7942_1723
CYORF: Synpcc7942_1723
UniProt: Q31MG6
LinkDB All DBs
Position
1795482..1797032
Genome map
AA seq 516 aa AA seqDB search
MSSSRESVDLIVIGSGLGGLCCGALAARYGLEVLVLEAHDRPGGAAHGFERRGFHFESGP
SLWSGLSRWPSTNPLAQVLRAIGEEVPVLTYREWGVLLPEGTFQIGVGNADFLKTVTALR
GPAAAQEWQDFMTWLAPYSAAANALPLLALRPGLSLINTLAGSAGKLLPHLGRMAALGGA
FGPIARRHLRDPFLLNWVELLCFLISGLPADQTSAAAMVTLFGEWFEPDACLEYPVGGSA
AIAEALVRGLRKHGGNLQVRSRVTEILVEGDRARGVRCADDQVIHARRAVVSNASIWDTL
NLLPEKSLPTRWRQQRQQTPACHGFLHLHLGLRGDDLQHLPLHHVWVGDWQRGITADRNM
VVLSMPSLLQPDLAPTGHQVLHGYTPANEPWALWKDLEPGSAAYEAQKRDRCQIFWDVLE
QLIPDVRDRAVISLEGTPRTQAHYLNTFQGSYGPAIGADQGLFPGCQTPIPNLLLCGASV
FPGIGVPPVATSGALAAHALVAASQQKKLLKEIGVL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtcccgtgaatctgttgacctgattgtgattggcagtgggctgggggggctc
tgttgcggagcgttggcagcccgctatggattagaagtacttgttctagaagcccacgat
cgtcccgggggcgcagcccatggcttcgagcgacgcggctttcactttgaatcagggcct
tcactttggtcaggactaagccgctggcccagcaccaacccgctagcgcaggtgctgcgg
gcgatcggcgaagaggtgccagttttgacctatcgagagtggggcgtgttactcccagaa
ggcacgtttcagatcggggttggtaacgcagatttcctcaaaacagtcacggccttgcga
gggcctgcagctgctcaagaatggcaggactttatgacgtggctggctccctacagtgca
gcggccaatgctctgcctttgttggcgctccgtccggggctgagtttgatcaacaccttg
gctggcagtgcgggtaaattgctgccccatttgggacgaatggccgctttgggaggtgcc
tttggcccgatcgctcgccggcacctccgcgatcccttcctgctcaactgggtggagttg
ctgtgctttttgatcagtggcctgcccgccgatcaaaccagtgcagcggcgatggtaacg
ctgttcggtgagtggtttgaacccgatgcctgcttggaatatcccgttggcggcagtgca
gcgatcgccgaagctcttgtgcgtggcctcagaaaacacggtggcaatttgcaagtgcgt
agccgcgtcacagaaattttggtggagggcgatcgcgcccggggcgtgcgctgtgctgat
gaccaggtgattcatgcccggcgagccgtggtcagcaacgccagcatttgggacacccta
aatctgctaccggagaagagtctaccgactcgttggcggcagcagcggcaacaaactccg
gcttgccacggatttttgcatctccatttggggcttcgcggcgatgaccttcagcatctg
cctctacaccatgtttgggtaggggattggcagcgaggcatcacagccgatcgcaacatg
gtggtgctctccatgccgtcgctcttgcaacctgaccttgcgcccacaggccatcaagtc
ctgcacggatataccccagccaatgagccctgggcattgtggaaggatttggagccgggt
agtgctgcctatgaagcgcaaaaacgcgatcgctgccagatcttttgggatgtactggaa
cagttgattccagatgtccgcgatcgcgccgtcatttccctggaagggacaccccgcact
caggctcactatctcaacacgtttcaaggcagctatgggcccgcgatcggggccgaccaa
ggcctattccccggttgtcaaacccccatccccaatttgttgctctgcggcgccagcgtt
tttccgggtattggagtgccgccagtagccaccagcggcgcgctagccgctcatgctttg
gtggctgctagccagcagaaaaaactgctcaaagagattggggttctttag

DBGET integrated database retrieval system