KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2117Help
Entry
Synpcc7942_2117   CDS       T00300                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00970  Aminoacyl-tRNA biosynthesis
syf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Synpcc7942_2117
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:syf03029]
    Synpcc7942_2117
Enzymes [BR:syf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Synpcc7942_2117
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Synpcc7942_2117
Mitochondrial biogenesis [BR:syf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Synpcc7942_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABB58147
CyanoBase: Synpcc7942_2117
CYORF: Synpcc7942_2117
UniProt: Q31LC2
LinkDB All DBs
Position
complement(2198155..2199594)
Genome map
AA seq 479 aa AA seqDB search
MASIRELHSQLVRKERSAVEIAEAALQRIETLEPQLKSFLHVTADQAIAQAKAVDQRIAA
GEEISLLAGIPIGIKDNLCTRGIPTTCASKILQGFVPPYESTVTQRLAEAGAVAVGKTNL
DEFAMGSSTENSAYQTTANPWDLTRVPGGSSGGSAAAVAADECVVALGSDTGGSIRQPAA
FCGVVGLKPTYGLVSRYGLVAYASSLDQIGPFSRSVEDTAILLGAIAGHDPKDATSLKVE
VPDYTQFLKPSLAGIKVGVITETVTDSPAGQAMQAALEVLQGLGAEIREISCPRFAYGLP
AYYIIAPSEASANLARYDGVKYGYRVEEAETLIDMYCRTRAEGFGSEVKRRIMIGTYALS
AGYYDAYYLKAQKVRTLIKQDFEAAFAEVDVLVSPTTPTTAFKAGEKTADPLSMYLSDLM
TIPVNLAGLPGLSLPCGFDEAGLPYGLQIIGNVLREDQVLHTAYAYEQATEWHLRQPAL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaattcgagaactgcacagccagctagttcgtaaggagcgcagtgcagtcgaa
attgctgaagcggcgctacagcgtatcgaaaccctcgagccacagctcaaaagttttttg
cacgtcacagctgatcaggcaatcgctcaagccaaggcagtagatcagcgaatcgctgcc
ggtgaagagattagccttctagcgggcattccgatcggcattaaggacaacctttgcacg
cggggtattcccactacctgcgcctccaagattttgcaggggtttgtccctccctacgag
tccaccgtcacccaacggcttgcagaagcaggagccgtagcggttggcaagacaaacttg
gatgagtttgccatgggcagctcgaccgagaactctgcttaccaaaccactgccaatccc
tgggacttaacccgtgttcctggcggatcgtccggggggtcggcggcagcggttgcagcg
gatgaatgcgtggttgccctcggttcagatacgggtggttccattcgccaacctgctgcc
ttttgcggcgttgttgggctgaagccaacctatggtctggtctctcgctatggcttagtc
gcctatgcgtcttcgctcgatcagattggccccttctctcggagcgtcgaagatacggcg
attttgttgggggcgatcgccggacatgatcccaaagatgccaccagcctcaaagtcgag
gtaccggactacacccagtttctcaagcccagtttggctggcatcaaggtcggcgtgatt
actgaaacggtgacagattcaccggcaggacaagcgatgcaggctgccctagaagtcctg
caggggctgggggcagaaattcgcgagatttcctgtccgcgcttcgcctatggtctgccg
gcttattacatcattgcgccgtcggaagcatcagcgaacttggctcgctatgacggtgtt
aagtacggctaccgcgtcgaagaagcagagaccctgatcgacatgtattgtcggacgcgg
gcagagggttttggcagcgaggtcaagcgccggatcatgatcggcacctatgcgttgtcg
gctggctactacgatgcctattacctcaaggctcagaaagttcgcacgctgattaagcaa
gactttgaagcagctttcgcagaagtcgatgttttggtttcacccacaaccccgaccacg
gctttcaaagcaggcgaaaaaactgccgacccgctgagcatgtacctgtcagacttaatg
accattccggtgaatttggccggtttgccaggcttgagcttgccctgtggctttgatgag
gctggtttgccctacggtttgcagatcatcggtaatgtcctgcgcgaagaccaggtgctc
catactgcctacgcttacgagcaggcaacggagtggcatctgcggcagccggcgctctag

DBGET integrated database retrieval system