KEGG   Synechococcus sp. CC9311: sync_0617
Entry
sync_0617         CDS       T00390                                 

Definition
(GenBank) 2-oxo acid dehydrogenases acyltransferase (catalytic domain) protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00010  Glycolysis / Gluconeogenesis
syg00020  Citrate cycle (TCA cycle)
syg00620  Pyruvate metabolism
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
syg01120  Microbial metabolism in diverse environments
syg01200  Carbon metabolism
Module
syg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sync_0617
   00020 Citrate cycle (TCA cycle)
    sync_0617
   00620 Pyruvate metabolism
    sync_0617
Enzymes [BR:syg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     sync_0617
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding
Other DBs
NCBI-ProteinID: ABI45271
CyanoBase: sync_0617
CYORF: sync_0617
UniProt: Q0ICI7
LinkDB
Position
588039..589172
AA seq 377 aa
MPAGSTAPVGETIGLIVETEAEIADVKAKAPSSAPAAPAAAAPPAAPAPPTPVSAPAAVS
APAPVTAPVAASVSNGRLIVSPRARKLASQMGVDLAGLRGTGPNGRIQAEDVEKAAGRPV
TPPRVGEGTSAAAVVGDTVSASPSAPSGNSFGAPGDTVAFNTLQAAVNRNMEASLAVPCF
RVGYTITTDKLDAFYKQVKLKGVTMTALLAKAVAVTLARHPQVNAATTASGMSYPAEVNV
AVAVAMEDGGLITPVLRNADRTDLYELSRQWGDLVKRSRSKQLQPEEYSTGTFTLSNLGM
FGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIYGADGAAF
LKDLAELIDTRPESLAL
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgcctgcgggtagcactgcacctgtgggtgaaacgattggcctgatcgttgagacggaa
gctgagatcgctgatgtgaaggccaaagctccttcttcagctccggccgctccagctgca
gccgccccccctgcggctccagcgccccccactcccgtttcagctcctgctgccgtttca
gctccagctcccgtcacagctccggtggctgcatctgtcagcaacggacgcttgatcgtc
agtccccgcgcccgcaagcttgcctcccaaatgggtgtagaccttgctggtctgcgcggt
actggccccaatggccggattcaggcggaagacgttgaaaaggcagccggacgtcctgtg
accccaccacgggtaggtgaagggacttcagccgctgccgttgttggtgacacagtctcg
gcttcaccgtcggctccttcgggcaacagttttggcgccccaggcgacaccgtggccttc
aacaccctgcaggcggcggtgaaccgcaacatggaagccagtcttgcggtgccttgtttc
cgtgttggatacacgatcactaccgacaagctcgatgccttttacaagcaggtaaaactc
aaaggcgtcacgatgacggcccttctggccaaagctgtggccgttactttggctcgccat
ccccaggtgaatgccgcaaccacggcttctggcatgagctaccccgctgaggtgaatgtg
gctgttgctgtggcgatggaagacggaggcttgattacgccggtattgcgcaatgccgat
cgcaccgatctatatgagttgtcgcgtcagtggggggatttggtgaagcgttctcgcagt
aagcaactgcagcctgaggaatacagcaccggcaccttcaccctctccaaccttggaatg
ttcggagtggatcgatttgatgccattctgcccccaggcaccggcgcaatcctggcggtt
gcggcgtctcgtcccaccgtggtggcaggcaaagacggatccatcgccgtgaagcgtcag
atgcaggtgaatctcaccgctgatcaccgcgtgatttatggcgccgatggtgctgccttc
ctcaaggatcttgcggaactgatcgacacgcgtccggagagtttggctctgtaa

DBGET integrated database retrieval system