KEGG   Synechococcus sp. CC9311: sync_0734Help
Entry
sync_0734         CDS       T00390                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00473  D-Alanine metabolism
syg00550  Peptidoglycan biosynthesis
syg01100  Metabolic pathways
syg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    sync_0734
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    sync_0734
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    sync_0734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syg01011]
    sync_0734
Enzymes [BR:syg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     sync_0734
Peptidoglycan biosynthesis and degradation proteins [BR:syg01011]
 Precursor biosynthesis
  Amino acid ligase
   sync_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 TTL DNA_processg_A
Motif
Other DBs
NCBI-ProteinID: ABI47405
CyanoBase: sync_0734
CYORF: sync_0734
UniProt: Q0IC71
LinkDB All DBs
Position
complement(686790..687851)
Genome map
AA seq 353 aa AA seqDB search
MPSSPVRIGVVFGGASGEHAVSIRSAITVINALQEGQNRDHFEVVPLYIDQEGRWWPEHI
ANSVLEQKQPLAEDSLPHPLPPAGFRSLPIDNDRVDVWFPVLHGPNGEDGTVQGLFTLMG
QPYVGSGVLGSAVGMDKLAMKAAFAAAGLPQVPYVGLNVADLNHPERQNKLVARIEAELG
YPCFVKPANMGSSVGISKARHRDQLLAGLKEAARHDTRLVVEHGVSARELECAVLGRQQL
KASVVGEISFEADWYDYETKYTDGCSQTLIPAPLPDQVSAQIQAIALQACTAVHAYGLAR
VDVFYDEKSGDIWLNEINTLPGFTSQSMYPMLWEASGVALPDLVAQLVHTARE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccctcttctcccgttcgcattggcgtggtgttcggaggagcatccggagagcatgcc
gtatcgattcgctcggccatcacggtgatcaatgcccttcaagaagggcaaaatcgagac
cacttcgaggttgttccgctctacatcgatcaggaggggcgttggtggcctgagcacatt
gccaacagcgtgctcgagcaaaagcagccgcttgcagaggacagccttccccatccccta
ccgcccgcaggctttcgttccctgccgatcgacaacgaccgggtggatgtttggttcccc
gtgcttcatggccctaacggagaggacggaacagtgcaagggttgttcacgctgatgggg
cagccttatgtgggctccggcgtgctcggttcagcagtagggatggacaagctggccatg
aaagctgcttttgccgccgcaggtttacctcaggttccctacgtggggctgaacgttgca
gacctcaatcaccctgaacgccaaaacaagctggtcgccaggatcgaagcggaattgggc
tatccatgttttgtcaaacccgccaatatgggctcatcggttgggatcagcaaagcgcgt
caccgagaccaactgcttgctggcctgaaagaagcagcgcgccatgacacccgcctcgtt
gtggagcatggtgttagcgcacgcgagttggaatgcgccgtacttggacggcaacagctg
aaggcttccgttgtgggcgaaatcagttttgaggccgattggtacgactacgagaccaaa
tacaccgacggctgcagccaaacgctgattccagcaccacttcccgaccaggtgagcgct
cagattcaggcgattgccctgcaagcctgcacagctgttcacgcctatggcttggcacgg
gttgatgttttttacgatgagaaaagcggtgacatctggctgaacgagatcaataccctg
cctggattcacctcccaaagtatgtatcccatgctttgggaggccagtggtgtcgcttta
cccgacctagtggcccagctggtccacacagcgcgagaatga

DBGET integrated database retrieval system