KEGG   Synechococcus sp. CC9311: sync_1975Help
Entry
sync_1975         CDS       T00390                                 

Gene name
chlL
Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00860  Porphyrin and chlorophyll metabolism
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    sync_1975 (chlL)
Enzymes [BR:syg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     sync_1975 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB SRP54 MipZ NB-ARC AAA_25 CBP_BcsQ RNA_helicase AAA_26 AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: ABI46262
CyanoBase: sync_1975
CYORF: sync_1975
UniProt: Q0I8P4
LinkDB All DBs
Position
1758279..1759169
Genome map
AA seq 296 aa AA seqDB search
MTTTLTRPADGDGSVQVHQDPGTKIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKRV
LQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFMFTGYNGVKCVESGGPPA
GTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFD
SIFAMNRIVQAIQAKAKNYKVRLGGVVANRSAETDQIDKFNERTGLRTMAHFKDVDAIRR
SRLKKCTIFEMDDKDDGVKAVQDEYIRLASNMLNNVEPLEAVSLKDREIFDLLGFD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaactctcacccgtccggcggatggtgacggcagtgttcaggtccatcaggac
ccagggacaaaaatagaggaaggagctcttgttattgccgtctatggcaaaggtggcatc
ggcaaatcgaccacctcctccaatctgtctgccgctttttcaaaacttggtaaacgggtt
ctccagattggttgtgatcccaagcacgacagcacattcaccctcacccacaaaatggtg
cctacggtgattgacatccttgaagaggtggactttcacagcgaagagctccgacccgag
gacttcatgtttacgggatacaacggcgtgaagtgtgtcgagagcgggggaccacccgcc
ggtaccggttgcggcggctatgtcaccggccaaaccgtgaagctacttaaggaacaccat
cttctcgaagacacagatgtggtgatctttgacgtgctgggcgacgttgtttgcggtggc
ttcgctgcaccgcttcagcacgcaaattattgcctcatcgtgaccgctaacgattttgat
tccatcttcgcgatgaacagaatcgtgcaggcgatccaagccaaagcgaaaaattacaag
gtacgccttggaggagtggtagccaatcgctccgcagagacagatcaaatcgataaattc
aatgaacgtacggggctacgcacgatggctcacttcaaagatgtcgatgcaattcgacgc
tcaagactgaagaaatgtacgatttttgagatggatgataaggatgacggcgttaaagct
gttcaagacgaatacattcgattagccagcaatatgctcaacaatgttgaaccattggaa
gccgtgtcactgaaagacagggagatctttgaccttctgggtttcgactga

DBGET integrated database retrieval system