KEGG   Synechococcus sp. WH 8109: Syncc8109_1877Help
Entry
Syncc8109_1877    CDS       T03783                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
syh  Synechococcus sp. WH 8109
Pathway
syh00473  D-Alanine metabolism
syh00550  Peptidoglycan biosynthesis
syh01100  Metabolic pathways
syh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Syncc8109_1877 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Syncc8109_1877 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Syncc8109_1877 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syh01011]
    Syncc8109_1877 (ddlB)
Enzymes [BR:syh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Syncc8109_1877 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:syh01011]
 Precursor biosynthesis
  Amino acid ligase
   Syncc8109_1877 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 DUF2625 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AHF64226
UniProt: W0H067
LinkDB All DBs
Position
1380585..1381508
Genome map
AA seq 307 aa AA seqDB search
MQPIYIDLEGRWWGTDLSEATLSSETAPELNPPLPPSGFQGFPKGCDAVDLWYPVLHGPN
GEDGTIQGLFQLTGKPFVGAGVLGSAVSMDKLAMKSAFASAGLSQVPYVALHASELENAI
SRSALLDRIERELNYPYFVKPANLGSSVGISKVRSRKELEAGLDQAAALDPRLVVEQGVN
AREVECAVLGGRMLEASLIGEVRFDADWYDYETKYTAGRSTTLIPAPLPDEVADRIRAQA
LQACAAVGVNGMGRVDFFYDDANDQLWINEINTLPGFTAQSMFPMLWAASGVTVEQLVHK
LIQTAGE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgcagccgatctacatcgaccttgagggtcgctggtggggaacggatctgtccgaggca
accctgtcctccgaaaccgcaccggagctcaacccacctctgcccccctcaggattccag
ggattcccgaagggatgtgatgcggtcgacctctggtacccggtgctgcatggtcccaat
ggagaggacggcaccattcaggggttgttccagctgaccggcaaaccattcgtgggcgcc
ggcgtgctcggctcagccgtcagcatggacaagctggctatgaaatctgccttcgccagc
gccgggctatcccaggtgccatatgtggcccttcacgcgtccgaactcgagaacgccatc
agccgatcggccctcttggatcggattgaacgcgaactgaactacccctactttgtgaag
cccgccaatctcggctcctctgtgggcatcagcaaggtgcgttcccgcaaagaactggaa
gcaggcctcgaccaggctgcagcgctcgatccaaggctggtggtggagcagggcgtcaac
gcccgagaggtggaatgcgcagtcctggggggacgcatgctcgaagcgtcgttgatcggt
gaggttcggtttgatgcggactggtacgactacgagacgaaatacaccgcagggcgcagc
accacgctgattccagctcccctgccggatgaagtggctgaccgcatccgcgcccaggcc
ctgcaggcctgcgctgccgtgggcgtcaacggcatgggtcgggtggatttcttctacgac
gacgccaacgatcagctctggatcaacgaaatcaacaccctgcctggtttcacggcccag
agcatgttcccgatgctctgggcggccagcggcgtaacagtcgaacagctggtgcacaaa
ctgatccaaaccgcaggagaatga

DBGET integrated database retrieval system