KEGG   Synechococcus sp. WH 8109: Syncc8109_1955Help
Entry
Syncc8109_1955    CDS       T03783                                 

Gene name
rbcL
Definition
(GenBank) Ribulose bisphosphate carboxylase, large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syh  Synechococcus sp. WH 8109
Pathway
syh00630  Glyoxylate and dicarboxylate metabolism
syh00710  Carbon fixation in photosynthetic organisms
syh01100  Metabolic pathways
syh01120  Microbial metabolism in diverse environments
syh01200  Carbon metabolism
Module
syh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Syncc8109_1955 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc8109_1955 (rbcL)
Enzymes [BR:syh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Syncc8109_1955 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AHF64299
UniProt: W0H0G5
LinkDB All DBs
Position
complement(1438670..1440085)
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKDSFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKSCYGPPNGIQVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLSEQETGERKGHYLNVTANTPE
EMYERAEFAKELGMPIVMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAGKHSPELAIALETWKEIKFEFDTVDKLDVQN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagggatacctactggactcctgat
tacgtccccctcgacaccgacctgctggcctgcttcaagtgcaccggccaagaaggtgtg
cccaaggaagaagttgccgctgctgtggctgctgaatcctccaccggcacctggtccact
gtgtggtctgagctcctcaccgatctcgacttctacaagggccgttgctaccgcatcgaa
gacgtccctggtgacaaggattctttctatgccttcatcgcctaccccctcgacctgttc
gaagagggttccatcaccaacgttctgacctccctggtcggcaacgtgttcggtttcaag
gctctccgccacctccgtctggaagacatccgcttcccgatggcgttcatcaagagctgc
tacggcccgccgaacggcatccaggtcgagcgcgaccggatgaacaagtacggccgtccc
ctgctgggttgcaccatcaagccgaagctcggcctgagcggtaagaactacggccgtgtt
gtctatgagtgcctgcgtggcggtctggacttcaccaaggacgacgaaaacatcaactcc
cagcccttccagcgttggcagaaccgcttcgaattcgttgcggaagccatcaagctgtcc
gagcaggagaccggcgagcgcaagggtcactacctcaacgtgactgcgaacactcccgaa
gagatgtatgagcgcgctgagttcgctaaggaactcggaatgccgatcgtcatgcacgac
ttcatcaccggtggcttcacagccaacaccggtctttcgaagtggtgccgcaagaacggc
atgctcttgcacattcaccgcgccatgcacgcggtgattgaccgtcatcccaagcacggc
atccacttccgcgttctcgccaagtgtctgcgtctgtccggtggtgaccagctccacacc
ggcaccgtggtcggcaagctggaaggtgatcgtcagaccaccctcggctacatcgaccag
ctgcgcgaatccttcgtgcccgaagaccgcagccgcggcaacttcttcgatcaggactgg
ggttccatgcctggcgtgttcgccgttgcttccggcggtatccacgtgtggcacatgcct
gcactggtcgccattttcggtgacgactccgtgctgcagttcggtggtggtacccacggt
cacccctggggctccgctgcaggtgctgctgccaaccgtgtggccctcgaggcctgcgtc
aaggcacgcaatgccggtcgcgagatcgagaaagaaagccgggacatcctcatggaagcc
ggtaagcacagccctgagctggccatcgctctcgagacctggaaggagatcaagttcgag
ttcgacaccgtcgacaagctcgacgttcagaactga

DBGET integrated database retrieval system