KEGG   Synechococcus sp. WH 8109: Syncc8109_1963Help
Entry
Syncc8109_1963    CDS       T03783                                 

Gene name
chlL
Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
syh  Synechococcus sp. WH 8109
Pathway
syh00860  Porphyrin and chlorophyll metabolism
syh01100  Metabolic pathways
syh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Syncc8109_1963 (chlL)
Enzymes [BR:syh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Syncc8109_1963 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH AAA_31 CbiA ArsA_ATPase ParA AAA_24 MeaB MipZ SRP54 NB-ARC AAA_16 AAA_25 CBP_BcsQ RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AHF64307
UniProt: W0GVL5
LinkDB All DBs
Position
1445820..1446710
Genome map
AA seq 296 aa AA seqDB search
MTTTLTRPADGEGSVQVHQDPEMNIQEETLVIAVYGKGGIGKSTTSSNLSAAFSKLGKRV
LQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFVFTGFNGVQCVESGGPPA
GTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFD
SIFAMNRIVQAIQAKAKNYKVRLGGVVANRSADTDQIDKFNDRTGLRTMAHFRDVDAIRR
SRLKKCTIFEMDDADEAVQAVQNEYLRLAQNMLDKVEPLEATSLKDREIFDLLGFD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgactctgacgcgaccagcggacggcgaaggcagcgtgcaggtccaccaggac
ccggaaatgaacatccaggaggagaccctggtgatcgcggtttatggcaaaggcgggatc
ggcaaatcgaccacctcctcgaacttgtcagccgccttttccaagctgggcaaacgggtg
cttcagatcggctgcgaccccaagcacgacagcaccttcaccctcacccacaagatggtg
ccgacggtgatcgacattctcgaggaggtggacttccacagcgaagagctgcggcctgag
gatttcgtcttcaccggcttcaacggggtgcagtgcgtcgaaagcggcggcccaccggcg
ggcacgggctgcggtggctacgtgactgggcagaccgtgaagctgctcaaggaacaccat
ctattggaagacaccgatgtggtgatctttgatgtgctcggcgatgtggtgtgtggtggt
ttcgccgccccgctgcagcacgccaactattgcctgatcgttacggccaacgatttcgat
tcgatcttcgcgatgaatcgcatcgttcaggcaattcaagccaaagccaagaactacaag
gtgcggcttggtggcgttgttgcgaaccgctcggcagacaccgatcagatcgacaagttc
aacgatcgcaccggcctgcgcaccatggcccatttcagggatgtggatgccatccggcga
tcccgactgaagaaatgcaccatctttgaaatggatgatgccgatgaagccgtgcaagcg
gtgcagaacgaatatctgcggctggcccagaacatgctcgacaaggtggagccgctcgag
gccacttccctcaaagaccgcgaaatcttcgacctgctgggattcgattga

DBGET integrated database retrieval system