KEGG   Synechococcus sp. WH 8109: Syncc8109_2101Help
Entry
Syncc8109_2101    CDS       T03783                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase component (E2) of pyruvate
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syh  Synechococcus sp. WH 8109
Pathway
syh00010  Glycolysis / Gluconeogenesis
syh00020  Citrate cycle (TCA cycle)
syh00620  Pyruvate metabolism
syh01100  Metabolic pathways
syh01110  Biosynthesis of secondary metabolites
syh01120  Microbial metabolism in diverse environments
syh01130  Biosynthesis of antibiotics
syh01200  Carbon metabolism
Module
syh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc8109_2101
   00020 Citrate cycle (TCA cycle)
    Syncc8109_2101
   00620 Pyruvate metabolism
    Syncc8109_2101
Enzymes [BR:syh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syncc8109_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AHF64439
UniProt: W0H0U7
LinkDB All DBs
Position
complement(1565566..1566885)
Genome map
AA seq 439 aa AA seqDB search
MATTDIFMPALSSTMTEGKIVEWLKQPGDKVARGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQANAPSAPAAALASAPAPAPTPAAVQAPAPTPA
PAPVAAPAPSVPVVNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQAEDVEQASGQP
ISVPRVAEGTAPAASSAGAAAAAAPAAPAGNSFGRPGETVAFNTLQGAVNKNMEASLAVP
CFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTAAGMAYPADV
NVAVAVAMEDGGLITPVLRNADRTDLYEMSRQWGDLVKRSRSKQLQPEEYSTGTFTLSNL
GMFGVDRFDAILPPGTGAILAVAASRPTVVANKDGSIAVKRQMQVNLTADHRVIYGADGA
AFLKDLADLIENRPESLAL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaccacagacatcttcatgcctgccctcagctccaccatgacggaggggaagatc
gtggagtggctgaaacagcccggagacaaggtggctcggggcgagtcggttcttgtcgtt
gagtccgataaagcggacatggacgttgagtccttccaggacggctacctcgcagcggtc
ctgatgcctgctggcagtacggctccggtgggcgaaaccatcggtctaattgttgaaacc
gaagctgagatcgccgacgcgcaggccaatgcccccagcgctcctgctgcagcgctcgcc
tctgcaccggctccggcccccacgccagctgcagttcaggccccagctccaaccccggca
ccggcacctgttgctgcccctgcaccgtcggtaccggtggtgaacgacggtcgcatcgtg
gccagcccccgggccaagaagctggcctcccagatgggtgtggacctggccaccgtgcgc
ggcagcggcccccatggccggattcaggccgaagacgtcgagcaagcctccggtcagccg
atctccgtgccccgggtggcggaaggaactgcccccgctgcttcctcggctggcgcagca
gcagcagcggccccagcagcgcctgcgggcaacagctttggtcggcccggcgagaccgtc
gccttcaacaccctccagggtgcggtgaacaaaaacatggaggcgagcctggcggttccc
tgcttccgcgttggttacaccatcaccaccgacaaactggatgccttctacaaacaggtg
aagcccaagggcgtcacaatgacggcactgctggccaaggctgtggccgtcaccctggcg
cggcacccccaggtgaatgccgccaccacagccgccggcatggcctatccagcggacgtg
aacgtggctgtcgccgtagcgatggaagacggcggcttgatcacgccggtgctgcgcaat
gctgatcgcaccgatctctatgagatgtcgcgtcagtggggtgatctggtcaagcgctcc
cgcagcaagcagctgcagcccgaggagtattccacgggcaccttcaccctttccaacctc
ggcatgttcggtgttgatcgcttcgacgcgatccttcccccaggcaccggggccattctc
gccgtcgccgcatcacgccccacggtggtggcaaacaaagacgggtccatcgccgtcaag
cgtcagatgcaggtgaacctgacggcggatcaccgggtgatttacggcgctgacggcgcc
gcattcctgaaggatctcgctgatctgatcgagaatcgtccagaaagtctggcgctctga

DBGET integrated database retrieval system