KEGG   Synechococcus sp. WH 8109: Syncc8109_2101
Entry
Syncc8109_2101    CDS       T03783                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase component (E2) of pyruvate
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syh  Synechococcus sp. WH 8109
Pathway
syh00010  Glycolysis / Gluconeogenesis
syh00020  Citrate cycle (TCA cycle)
syh00620  Pyruvate metabolism
syh01100  Metabolic pathways
syh01110  Biosynthesis of secondary metabolites
syh01120  Microbial metabolism in diverse environments
syh01200  Carbon metabolism
Module
syh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc8109_2101
   00020 Citrate cycle (TCA cycle)
    Syncc8109_2101
   00620 Pyruvate metabolism
    Syncc8109_2101
Enzymes [BR:syh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syncc8109_2101
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding SWI-SNF_Ssr4
Other DBs
NCBI-ProteinID: AHF64439
UniProt: W0H0U7
LinkDB
Position
complement(1565566..1566885)
AA seq 439 aa
MATTDIFMPALSSTMTEGKIVEWLKQPGDKVARGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQANAPSAPAAALASAPAPAPTPAAVQAPAPTPA
PAPVAAPAPSVPVVNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQAEDVEQASGQP
ISVPRVAEGTAPAASSAGAAAAAAPAAPAGNSFGRPGETVAFNTLQGAVNKNMEASLAVP
CFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTAAGMAYPADV
NVAVAVAMEDGGLITPVLRNADRTDLYEMSRQWGDLVKRSRSKQLQPEEYSTGTFTLSNL
GMFGVDRFDAILPPGTGAILAVAASRPTVVANKDGSIAVKRQMQVNLTADHRVIYGADGA
AFLKDLADLIENRPESLAL
NT seq 1320 nt   +upstreamnt  +downstreamnt
ttggcgaccacagacatcttcatgcctgccctcagctccaccatgacggaggggaagatc
gtggagtggctgaaacagcccggagacaaggtggctcggggcgagtcggttcttgtcgtt
gagtccgataaagcggacatggacgttgagtccttccaggacggctacctcgcagcggtc
ctgatgcctgctggcagtacggctccggtgggcgaaaccatcggtctaattgttgaaacc
gaagctgagatcgccgacgcgcaggccaatgcccccagcgctcctgctgcagcgctcgcc
tctgcaccggctccggcccccacgccagctgcagttcaggccccagctccaaccccggca
ccggcacctgttgctgcccctgcaccgtcggtaccggtggtgaacgacggtcgcatcgtg
gccagcccccgggccaagaagctggcctcccagatgggtgtggacctggccaccgtgcgc
ggcagcggcccccatggccggattcaggccgaagacgtcgagcaagcctccggtcagccg
atctccgtgccccgggtggcggaaggaactgcccccgctgcttcctcggctggcgcagca
gcagcagcggccccagcagcgcctgcgggcaacagctttggtcggcccggcgagaccgtc
gccttcaacaccctccagggtgcggtgaacaaaaacatggaggcgagcctggcggttccc
tgcttccgcgttggttacaccatcaccaccgacaaactggatgccttctacaaacaggtg
aagcccaagggcgtcacaatgacggcactgctggccaaggctgtggccgtcaccctggcg
cggcacccccaggtgaatgccgccaccacagccgccggcatggcctatccagcggacgtg
aacgtggctgtcgccgtagcgatggaagacggcggcttgatcacgccggtgctgcgcaat
gctgatcgcaccgatctctatgagatgtcgcgtcagtggggtgatctggtcaagcgctcc
cgcagcaagcagctgcagcccgaggagtattccacgggcaccttcaccctttccaacctc
ggcatgttcggtgttgatcgcttcgacgcgatccttcccccaggcaccggggccattctc
gccgtcgccgcatcacgccccacggtggtggcaaacaaagacgggtccatcgccgtcaag
cgtcagatgcaggtgaacctgacggcggatcaccgggtgatttacggcgctgacggcgcc
gcattcctgaaggatctcgctgatctgatcgagaatcgtccagaaagtctggcgctctga

DBGET integrated database retrieval system