KEGG   Sediminicola sp. YIK13: SB49_04735Help
Entry
SB49_04735        CDS       T04145                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
syi  Sediminicola sp. YIK13
Pathway
syi00564  Glycerophospholipid metabolism
syi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SB49_04735
Enzymes [BR:syi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SB49_04735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Plasmodium_Vir HI0933_like Pyr_redox_2 Lycopene_cycl NAD_binding_8 Thi4 GIDA
Motif
Other DBs
NCBI-ProteinID: ALM09170
UniProt: A0A0S1S939
LinkDB All DBs
Position
1063866..1065428
Genome map
AA seq 520 aa AA seqDB search
MLKGLKSTKNWDVIIIGGGATGLGIALDSVTRGYKTVLLEQVDFAKGTSSRSTKLVHGGV
RYLAQGDIGLVKEALYERGLMLKNAAHLVSNQSFIIPNYRWWDGIFYTTGLKIYDLLAGK
LSLGKSFHINKNETHNRLKTLKTEHLKGGVVYQDGQFDDSRLAINIAQTAIENGATLLNH
FEVQKLRKDDTGTVNGVLAIDRESGTEYALNGKVVINATGVFTDEILQMDNEYAKNMVRP
SQGIHFVLDKSFLPGDDAIMIPKTDDGRVLFLVPWHDKVVVGTTDTVLDSHSLEPIALEE
EINFILNTANKYLTKKVERKDVLSVYAGLRPLAAPQDESEKTKEISRSHKIIISNSGLVT
ITGGKWTTYRRMAQDTLNKVIEKGKLKKKTCKTISLSIHGSTDIMDRNNHLYIYGTDYQE
IKKLIQKDPELGEKLHPNLDFLKAEVVWAVRNEMARTIEDVLARRVRALFLDARAAIEIA
PLVADILAKELEKSLEWKTSQILAFNAIAKNYILKGQPKS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
attcttaaaggtctaaaaagtaccaaaaactgggatgtaataattattggtggtggtgcc
acaggtcttggaatagctttggatagtgttacgaggggctataaaacggtacttttggaa
caagtagattttgcaaaaggcacatccagtagaagcactaaattggtacacggtggggtc
cggtatttggctcaaggtgatataggtttggttaaagaggccttatatgaaaggggatta
atgctaaaaaatgctgcacatttagtatcaaatcagtcctttatcatacctaattacagg
tggtgggatggtattttttataccacgggtctcaaaatatatgatcttttggcgggaaaa
ttaagtttgggaaaatcgttccatatcaataaaaacgaaactcataataggttaaaaacc
ctaaaaaccgaacatttaaaaggaggcgttgtatatcaagatggtcaatttgatgattct
agattagcgattaatatagcccaaacagccattgaaaatggggcaacccttctcaatcat
tttgaagtacaaaagttgagaaaggatgatacaggaactgttaacggtgtacttgcaata
gatagggagtcaggaacagagtatgccctaaatggcaaggtggtcatcaatgccactggc
gtatttacggatgaaatattacaaatggacaatgaatatgccaaaaatatggtgcgcccc
agtcaggggatacatttcgttttggataaatcttttttacctggggatgatgccatcatg
attccaaaaacggatgatggacgagtccttttcctggtaccttggcatgataaggttgtg
gttgggactactgacaccgttttggacagtcatagcctggaaccgatagccttagaagag
gaaatcaactttatcctcaatacggccaataaatacttgaccaaaaaagtggaaagaaaa
gatgtccttagcgtatacgcgggattaaggcctttagcggcgccacaagatgagtctgaa
aaaacaaaggaaatatctagaagtcataaaatcattatttccaattcgggactagttacg
ataactggcggcaaatggaccacctatcgaagaatggcacaggataccttgaacaaggta
attgaaaaagggaaattgaaaaagaagacctgcaagacaatttctctttccatacatggt
tcaactgatatcatggatcgtaacaatcacttatatatctatggtacggattaccaagaa
attaagaaattaatacaaaaagatcctgaacttggagaaaaactacatccaaatttagat
tttctaaaagcagaagtggtttgggccgtaagaaatgaaatggcccgaactattgaggat
gtactggccagacgtgttagggccctatttcttgatgcaagggcagcaatagaaatagcc
cctttggttgccgatattttggcaaaagaacttgaaaagtctttagaatggaaaacctcg
caaatcttagcattcaatgctatagcaaaaaattatatcttaaaaggccaaccaaaaagt
taa

DBGET integrated database retrieval system