KEGG   Sediminicola sp. YIK13: SB49_10220Help
Entry
SB49_10220        CDS       T04145                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syi  Sediminicola sp. YIK13
Pathway
syi00620  Pyruvate metabolism
syi00680  Methane metabolism
syi01100  Metabolic pathways
syi01120  Microbial metabolism in diverse environments
syi01200  Carbon metabolism
Module
syi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:syi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SB49_10220
  09102 Energy metabolism
   00680 Methane metabolism
    SB49_10220
Enzymes [BR:syi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SB49_10220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ALM08136
UniProt: A0A0S1SCH7
LinkDB All DBs
Position
complement(2304459..2307008)
Genome map
AA seq 849 aa AA seqDB search
MPKLERIEEFRKSVNNKFNVYNSLFLSLPYRNIENVGMLIPLLMHQADEGLKSGKNPLEI
LDAFFQNYANIESEKDRIDFMFSIIQYVERQVVLYDSVEDAAFPKLQEHSNSLTIKDYAQ
MVEKNKSWDEISEKLSTFSARIVLTAHPTQFYTPAVLDIMDNLRALIVDNKINEIDVTLQ
QLGLTSLINAQKPTPLVEAKNIIHILRNVYYNAIGELYSYIKEHIQKEDFDNHNIMKLGF
WPGGDRDGNPFVTASMTNQVADELRTTLMKCYYHDIKSLQQKLSFTDLQELINGLRNKLY
VTMFNEKKIMGYEEIIGPLLQIREILIREYNSLYLKDLDQLIDKVKIFKTHFATLDIRQD
HSVHRNTVEAILKQQGVITESLEELSEAELIDNLLHKKFKLQHENFEDDLVRDTIENIAQ
LKNIQSKNGEEGCNRYAISNSEDIFSVLFVYGLLRWCGDWEEGKIPFDIVPLFETMNGMA
TSENTMNGVFDLPEYRAHVRFRDNKQTIMLGFSDGTKDGGYVKANWSIFKTKENLSAVCG
QRDIKAIFFDGRGGPPARGGGKTHRFYAAQTKNIANNEIQLTIQGQTITSNYGTKDLFMH
NCQQLLTAGLSNDLFGKENSISKEMRQLIEELSELSFAKYDALKHHDKFMPYLEEKSTLK
YYNKANIGSRPGKRGNKAKLELTDLRAISFVGSWSQLKQNVPGYFGIGTAIKTLKDRGQL
NEMKRLFQEVPFFKALMLNSMMALSKCYFELTSYMKDDKEYGEFWNILYDEYLLSKEMLL
LISDFKILMEEEAVSRESIKIREAIVLPLLVIQQYALQKIGQGSDHLELYEKIVTRSLYG
NINASRNSA
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattggaaagaatagaagagtttaggaaatcggtcaataacaaattcaatgta
tacaacagtctatttcttagtttgccctatagaaatatagaaaacgtgggaatgttgatt
cctttgttgatgcaccaggcagatgagggacttaaatcgggtaaaaatccattggagata
ctggatgccttttttcagaactatgcaaatatagaatcggaaaaggacaggatcgacttt
atgttcagtattattcaatatgtggaacgccaagtggttttatacgacagtgtggaagat
gccgcttttccaaagctccaggagcatagtaattcgttgacgataaaggattacgcccaa
atggtggaaaaaaataaaagttgggacgaaatatctgaaaaattgtcaacctttagtgcg
cgaattgtattgactgcccaccctacacagttttatacccctgcagtactggatatcatg
gacaacctaagggcattgatcgtggataataagatcaatgagatagatgttaccctgcaa
cagttgggacttacttccttaataaatgcccaaaagcctactcctttggtagaggccaaa
aatatcatccatattttaaggaatgtgtattacaatgctattggcgaactatattcctat
ataaaggaacatatacaaaaggaggactttgataaccataatattatgaagttggggttc
tggcccggtggggatagggacggtaatccttttgtaacggcttcgatgaccaaccaggta
gctgatgaacttaggacaaccttaatgaagtgctattaccatgatataaagtcactgcaa
caaaaattgagtttcacagatttgcaggagttgatcaatgggttaaggaataagctttat
gttaccatgttcaatgagaaaaagatcatggggtatgaagaaatcattggtccgctttta
cagattcgggaaatattgattagggaatacaattcattgtacctaaaagatttggatcag
cttatcgataaggtcaaaatattcaaaacacatttcgcgaccttggacataagacaggac
catagcgtgcacaggaataccgtggaagctattttgaagcaacaaggagtcatcacggaa
agtctggaggagttgagtgaagctgaacttatagataacctgttgcacaaaaaatttaaa
ctgcaacacgaaaattttgaggatgatcttgtgcgggataccatagagaacatagcccaa
ttaaaaaatattcaaagtaaaaatggggaggaaggttgtaacaggtacgctataagcaat
tccgaagatatcttttccgtacttttcgtttatggcctattaagatggtgcggagattgg
gaagaaggtaaaatacctttcgatattgtgcctttgtttgagaccatgaatggaatggcg
acctcagaaaataccatgaacggggtcttcgatttacctgaatatagagcccatgttaga
tttagggataataaacagaccatcatgctgggcttttctgatggtaccaaagatggaggc
tatgtaaaggccaactggtctatctttaaaaccaaagaaaatctatcagccgtatgcgga
caaagggatattaaagctatattttttgacggtcgtggtggaccaccggcacgtggaggt
gggaaaacgcatcgtttttatgctgcacagaccaagaatatagccaataatgaaatacag
ctcaccattcaaggccagaccattaccagtaactatgggacaaaggacttgtttatgcac
aactgtcagcaattgctaaccgcaggtctgtccaatgatctgtttgggaaagaaaactcg
atatccaaggagatgcgccaattgatagaggaattgtcggaacttagttttgccaagtat
gacgccctcaaacaccatgacaagtttatgccctacttggaggaaaaaagcaccttaaag
tattataacaaagctaacatagggagtagacctggcaaaagaggaaacaaggcgaaactg
gaacttacagatcttagagccatatcctttgtgggctcatggagccaattaaaacaaaat
gtaccgggctattttggaataggaactgctatcaaaaccttaaaggatagggggcaactt
aatgagatgaaaagactctttcaggaagttccttttttcaaggcgcttatgctgaacagt
atgatggccctttcaaaatgttattttgagctgaccagttatatgaaggatgataaggaa
tatggcgaattttggaatatcttatatgatgagtatttgctgtcaaaagaaatgcttctt
ttgatttctgatttcaagatattaatggaagaagaggccgtatctagggagtcaataaaa
attagggaagctatcgtgctgccattattggtaattcaacagtatgcactacaaaaaatt
ggtcagggatcagaccatttggagttatacgaaaagatagtgacaaggtccctatacgga
aacatcaatgcgagtagaaactcggcctaa

DBGET integrated database retrieval system