KEGG   Sediminicola sp. YIK13: SB49_12830Help
Entry
SB49_12830        CDS       T04145                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syi  Sediminicola sp. YIK13
Brite
Enzymes [BR:syi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SB49_12830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALM08586
UniProt: A0A0S1S7D5
LinkDB All DBs
Position
2880581..2881189
Genome map
AA seq 202 aa AA seqDB search
MAFELPKLPYAYDALEPHIDAKTMEIHHTKHHNGYTNNLNNAIEGTDLAGKSIEDILHNL
DMSNTAVRNNGGGFYNHSLFWEVMSPKGGGEPSGEVADAINSAFGSYDSFKDAFAKAAGT
RFGSGWAWLCVHKGGKLEICSTPNQDNPLMPDVGCGGFPILGLDVWEHAYYLNYQNRRPD
YITHFYNIINWNKVAELYKANK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattacctaaattaccatatgcatacgatgcattggaacctcatattgat
gcaaaaacaatggaaatacaccatacaaagcatcacaatggatataccaacaacttgaat
aacgctattgagggaaccgaccttgccgggaaatccatagaggatatcctgcacaatttg
gacatgtccaatactgccgtaaggaacaatggaggtggattttacaatcactccttgttc
tgggaagtaatgtccccaaaaggtggaggtgaacccagtggagaagtggctgatgccatc
aattccgcgtttggatcgtacgatagttttaaagatgcctttgcaaaggctgcaggtaca
agatttggttccggttgggcatggctatgtgttcataaaggagggaaattggaaatttgc
tccacacctaatcaggataacccattaatgccagatgttggatgtggtggattcccaatt
ttgggactggatgtttgggagcatgcgtattacctaaattaccaaaatagaagacctgac
tatattacacatttctataatattatcaactggaataaagttgcagaactttacaaagcc
aacaaataa

DBGET integrated database retrieval system