KEGG   Sediminicola sp. YIK13: SB49_13015Help
Entry
SB49_13015        CDS       T04145                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
syi  Sediminicola sp. YIK13
Pathway
syi00010  Glycolysis / Gluconeogenesis
syi00053  Ascorbate and aldarate metabolism
syi00071  Fatty acid degradation
syi00280  Valine, leucine and isoleucine degradation
syi00310  Lysine degradation
syi00330  Arginine and proline metabolism
syi00340  Histidine metabolism
syi00380  Tryptophan metabolism
syi00410  beta-Alanine metabolism
syi00561  Glycerolipid metabolism
syi00620  Pyruvate metabolism
syi00625  Chloroalkane and chloroalkene degradation
syi01100  Metabolic pathways
syi01110  Biosynthesis of secondary metabolites
syi01120  Microbial metabolism in diverse environments
syi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SB49_13015
   00053 Ascorbate and aldarate metabolism
    SB49_13015
   00620 Pyruvate metabolism
    SB49_13015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SB49_13015
   00561 Glycerolipid metabolism
    SB49_13015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SB49_13015
   00310 Lysine degradation
    SB49_13015
   00330 Arginine and proline metabolism
    SB49_13015
   00340 Histidine metabolism
    SB49_13015
   00380 Tryptophan metabolism
    SB49_13015
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SB49_13015
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SB49_13015
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SB49_13015
Enzymes [BR:syi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SB49_13015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALM08622
UniProt: A0A0S1SED4
LinkDB All DBs
Position
complement(2918716..2920269)
Genome map
AA seq 517 aa AA seqDB search
MSKIATTFGIHDALKQLGIQDINPGTSTGSHNFSTGDILASHSPVDGALIAKVKTTSKED
YDKVMEAATSAFKTWKNKPAPLRGEIVRQFGDKLRELKEPLGKLVSYEMGKSYQEGLGEV
QEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGVVGIISAFNFPVAVWAWNTAL
AWVCGDVCVWKPSEKTPLCGIACQNIAAAVLKENNLPEGISCLINGDYQVGEYMTKDARI
PLVSATGSIRMGKIVAQAVAARLGKSLLELGGNNAIIVTPDADLKMTVIGAVFGAVGTAG
QRCTSTRRLIVHESMYDKVKEAVVAAYNQLRIGNPLDENNHVGPVIDKDAVKMYQNALKK
VVEEGGKIIVEGGVLEGEGYESGCYVKPAIAEAENSFEIVQHETFAPILYLLKYSGDVEN
ALAIQNGVVQGLSSAIMTNNLREAERFLSVNGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKIYMRRQTNTINYTTELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatagctacaaccttcggaatccatgatgccttaaaacaactcggaatccaa
gatataaatcctggcacctctactgggtcccataatttttcaacaggagacatccttgcc
tctcattccccagttgatggtgctttgatcgcaaaagtaaaaacaacctccaaagaagat
tacgataaggttatggaggctgccacctcagcatttaaaacttggaaaaacaagcctgct
ccattgaggggcgagattgtacgtcagtttggggacaaactacgcgagttaaaagagcct
cttggaaagttggtgtcctatgaaatgggaaaatcctatcaagagggactaggagaagta
caggaaatgatagatatctgtgatttcgccgttggtctatccaggcagttgcacggtttg
accatgcattctgaacgtcccggacaccgtatgtacgagcagtaccatccattaggggtt
gtaggtatcatctctgcctttaacttccctgtagccgtttgggcatggaatacagccttg
gcttgggtatgtggagatgtatgtgtttggaagccttcagaaaagacacctttatgtggg
attgcctgtcaaaatatcgctgcggccgtattgaaggaaaacaatctgccagagggaatc
tcttgtttaatcaatggagattaccaagttggtgaatacatgaccaaagacgctagaata
ccattggtttctgccacaggatctatccgtatgggtaaaattgtagcccaggcagtcgca
gctagacttggaaagtctttattggaattaggaggaaacaatgccattatcgttactcca
gatgcagacttaaaaatgaccgttataggggccgtgtttggcgcagtgggtaccgcagga
caacgttgtacctctacgcgtaggttaattgtccatgaatctatgtatgacaaggttaag
gaagccgtcgtagctgcctacaatcaactgcgcattggaaatcctttggatgagaataac
catgttggtcccgttattgataaagatgctgtaaaaatgtaccaaaacgctcttaaaaaa
gtagttgaggaaggtggcaaaatcattgttgaaggtggtgtactcgaaggtgaaggatat
gaaagtggctgttatgttaaaccagccattgcggaagctgaaaattcctttgaaattgta
cagcatgaaacatttgcacccatactttatctactaaaatattccggtgatgtagagaac
gcacttgccatccaaaatggagtggttcaggggctttcttcagccatcatgaccaataac
cttagagaggcagaaagattcctttctgtcaatggtagtgattgcggtattgccaatgta
aacatcggtacctcaggagctgaaataggtggcgccttcggaggagaaaaagaaactggg
ggcggaagagaatccggttcagatgcttggaaaatttatatgcgcagacaaaccaatacc
attaactatacaacggagctgcctttggcccaaggtataaagtttgacctataa

DBGET integrated database retrieval system