KEGG   Synechocystis sp. PCC 6714: D082_06980Help
Entry
D082_06980        CDS       T03386                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
syj  Synechocystis sp. PCC 6714
Pathway
syj00564  Glycerophospholipid metabolism
syj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D082_06980 (glpD)
Enzymes [BR:syj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D082_06980 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 Pyr_redox_2 Thi4
Motif
Other DBs
NCBI-ProteinID: AIE73227
UniProt: A0A068MZS8
LinkDB All DBs
Position
complement(681175..682836)
Genome map
AA seq 553 aa AA seqDB search
MRNFPEIQNTAYDLIVIGGGINGVGTARDGALRGLKTLLIEKDDFASGTSSWSTRLIHGG
LRYLEYFEFNLVRESLREREVLLHSAPHLVQPLQLTIPIYDWSSRTYWEIQAGMILYDIL
SFDKTLPSHRMLRPQQFRQLFRAAEKKGLKGGAQYFDGQVEYAERLALEVALSAQTAGAT
MLNYVAVKGLEKEDNNLITAIHCQDQLTGEKFIVNSSQAIVINTAGPWVDRVCGLAQQGG
NPVSIVNGRKIGGTKGSHIIVDPFPGAPTSALYVEAFVDKRPYFIIPWLGKYLIGTTDHR
YEGSLDSVKASDDEIDYLIAETNRVMPAAQLTREDVRFTYSGVRPLPYSDGKKAGSITRN
HILYDHSPDGVENLISLIGGKLTTYRQVGQEMVDRVCQKLGRTVPPCKTLTEPLPGAEAY
PLTLETAMDKYGDHLERHSIQHLFCLYGARAGEVLALVHEAPELGESILPSLPDIKAQIV
FSIRTEMAHTLVDICRRRTAIAMVTNDYGFSTLAGICQTLMDHCGWTQEQCNEQIQEYHK
YMEQNCIPDYCLN
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatttcccagagatccaaaatacggcctatgacctaattgtgattgggggaggc
attaatggggttggcacggcccgggatggggccctaaggggactaaaaaccctgctgatt
gaaaaggatgattttgcgagtggcaccagcagttggtccacccgcttaatccatggcggc
ctgcgctatctggaatattttgaatttaatctggtgcgggaatctctgcgggaacgggaa
gtcttgctccacagcgcccctcatttggtgcaacctttgcaattaactatccccatttat
gactggtcgagccgaacctattgggaaattcaagcgggcatgattctttacgacattctc
agttttgataaaactttgccttcccatcgcatgttaaggccccaacagtttcggcaatta
tttcgagcggcggagaaaaaaggcttaaagggaggagcccaatattttgatggccaggtg
gaatatgcggagcgcctagctttagaagtggccctatcggcccaaacggctggggcgacc
atgctcaattatgtggcggtgaagggtttggagaaagaagacaataacttgatcacagcc
atccattgccaagatcaactgactggagaaaaatttatcgttaatagttcccaggcgatc
gtcattaacaccgctgggccctgggtggaccgggtttgtggtctagctcagcagggggga
aatcccgttagtatcgttaacggacgaaaaattggtggcactaagggaagccatattatt
gtcgatccctttccgggggcaccaacttcggcactgtatgtggaagcttttgtcgataaa
agaccctactttattattccttggttaggtaaatatttaattggtactaccgaccatcgg
tatgaaggctcactcgattcggtcaaagctagtgacgacgaaattgattatctaattgcg
gaaactaatcgggttatgccggcggcccagttaaccagggaagacgtgcgctttacctat
tccggggtgcggcctctgccctacagcgacggtaaaaaagcgggcagtattacccgtaac
catattttgtacgaccacagccctgatggggttgagaatctaatctctttgattggcggt
aagttaacgacctatcgtcaggtgggccaggaaatggttgaccgggtttgccaaaaactg
gggcgcaccgttcccccctgtaaaactttaactgaacctttaccgggggcagaggcctat
ccccttactttggaaactgctatggataaatacggcgatcatctggaacgccattccatc
caacatttattttgcttatacggagccagggcgggggaagttttagctttagtgcatgaa
gcaccggagttaggggaatctattctcccttccctaccggatatcaaagcgcagatcgtt
ttttcaatacgcacagaaatggcccacaccctggtggatatttgccgacgacgcacggcg
atcgccatggtgaccaatgattacggcttcagcactctagccggtatttgccaaacgtta
atggaccactgtggctggacccaggagcaatgtaacgaacaaattcaagagtatcataaa
tacatggaacaaaattgcatccccgactattgcttaaactga

DBGET integrated database retrieval system