KEGG   Synechocystis sp. PCC 6714: D082_13890Help
Entry
D082_13890        CDS       T03386                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syj  Synechocystis sp. PCC 6714
Brite
Enzymes [BR:syj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     D082_13890 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIE73917
UniProt: A0A068N1M3
LinkDB All DBs
Position
1377570..1378169
Genome map
AA seq 199 aa AA seqDB search
MAYALPNLPYDYTALEPCISKSTLEFHHDKHHAAYVNNFNNAVAGTDLDNQSIEDVIKAV
AGDASKAGIFNNAAQAWNHSFYWNCMKPGGGGQPTGALADKINADFGSFDAFVEAFKQAG
ATQFGSGWAWLVLDNGTLKVTKTGNAENPMTAGQTPLLTMDVWEHAYYLDYQNRRPDYIA
DFLGKLVNWDFVAANLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgcactacctaacttaccctacgactacacggccctggaaccctgcatttcc
aaaagcactctggagttccaccatgataaacaccacgccgcctatgttaacaatttcaac
aatgcagtggcgggtactgatttagataatcaatccatcgaagacgtaattaaggccgtt
gctggggacgctagtaaagccggtattttcaacaatgccgcccaagcttggaaccatagt
ttctattggaattgcatgaagcccggtggtggtggccagcccactggtgctttggcggat
aaaatcaatgccgatttcggtagctttgatgcttttgtagaagctttcaaacaggctggt
gccacccaattcggtagcggttgggcttggttggtattggacaatggcactttgaaagtg
accaaaactggcaatgccgaaaatcctatgactgcgggtcaaactcctttgttgaccatg
gatgtgtgggaacacgcctattatttggattaccagaaccgtcgtcccgactacattgct
gattttctcggtaagttggtcaactgggactttgtggcggctaacttagcagcggcctag

DBGET integrated database retrieval system