KEGG   Synechocystis sp. PCC 6714: D082_28720Help
Entry
D082_28720        CDS       T03386                                 

Gene name
gad
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
syj  Synechocystis sp. PCC 6714
Pathway
syj00250  Alanine, aspartate and glutamate metabolism
syj00410  beta-Alanine metabolism
syj00430  Taurine and hypotaurine metabolism
syj00650  Butanoate metabolism
syj01100  Metabolic pathways
syj01110  Biosynthesis of secondary metabolites
syj01120  Microbial metabolism in diverse environments
syj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:syj00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    D082_28720 (gad)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D082_28720 (gad)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D082_28720 (gad)
   00430 Taurine and hypotaurine metabolism
    D082_28720 (gad)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    D082_28720 (gad)
Enzymes [BR:syj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     D082_28720 (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIE75400
UniProt: A0A068MZU5
LinkDB All DBs
Position
complement(2850587..2851990)
Genome map
AA seq 467 aa AA seqDB search
MVHKKIDLNQLSPLESLLTPTYAARGLVNPVSKYEMPETEMLPAIAYNLIHDELGLDGNS
RLNLATFVTTWMEPEARQLMADTFDKNMIDKDEYPQTAEIELRCVNILSRLWNAPENAEA
TGCSTIGSSEAAMLGGMAMKWKWRKRRQIEGKSGDRPNLVMGINVQVCWEKFCRYWEVEP
RFVPMEGDRYHISPDEAVKLIDENTIGVIGILGSTFDGSYEPIEALNDALEILNERTGWQ
VPLHVDAASGGFIAPFLDPDLRWDFRLPWVKSINTSGHKYGLVYPGVGWIIWRDKEELPE
ELIFHCSYLGGDLPNFALNFSRPGNQVVAQYYNFLRLGKEGYRKIQQACRDTALYLSSKI
AQLGPFELLTDGGDIPVFAWKLKDDVLAHSCYTLYDMADKLRERGWLAPAYPMPKNRDDL
VVQRIVVKEGFSRDMADILLADMERAIAYFVSQPDHKPKQGGSHFSH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtgcataaaaaaattgacctcaaccaactcagcccattagaaagcctactgaccccc
acctatgcggcccggggattggtcaaccccgtgagcaagtacgaaatgccggaaacggaa
atgctgccggcgatcgcctataacctgatccacgatgaactgggcctagatggcaattcc
cgtttgaacttagccactttcgttaccacttggatggagccggaagcccggcaactgatg
gcggataccttcgataaaaatatgatcgataaggatgagtatccccaaacggcagaaatt
gagttgcggtgcgtcaatattttgtcccgactttggaatgccccggaaaatgctgaggct
actggctgttccaccattggctccagtgaagcggcgatgttggggggcatggccatgaag
tggaaatggcgaaaacgtcgacagatcgagggaaaatcaggcgatcgccctaatctggtt
atgggtattaatgtccaggtttgttgggaaaagttttgccgttattgggaagtcgaaccc
cgctttgtgcccatggaaggcgatcggtaccatattagtcctgacgaggcagttaaatta
atcgacgaaaataccattggtgtaattggcattttaggtagcacctttgacggcagttac
gaacccattgaagcgcttaacgatgccctagaaatattaaatgagagaacaggctggcag
gtgcccctgcatgtggatgccgccagtggcggtttcattgcgccctttctagacccagat
ttacgctgggattttcgtttaccctgggtgaaatccatcaatacttctggacataagtac
ggtttagtttatccaggggtgggctggattatctggcgggataaggaagaattaccagag
gaattgattttccattgcagctatttggggggagatttgcccaattttgccctcaacttt
tcccgtcctggcaatcaggtagtggcccagtattacaactttctccgtttaggcaaagaa
ggttatcgtaaaattcagcaggcctgtcgagatacggctctatacttatccagcaaaatc
gcccaattggggccctttgaactgctcaccgatggcggcgacattccggttttcgcctgg
aaattgaaggatgacgtgttggcccatagttgttacaccctctacgacatggccgacaaa
ttgcgggaacggggttggttggcgcctgcctatcccatgcccaaaaaccgtgatgattta
gtagtgcaaaggattgtggtcaaagagggttttagtcgggatatggccgatattttgcta
gcggacatggaaagggcgatcgcctattttgtcagtcaaccagaccataaaccaaaacaa
gggggatcccacttcagccattag

DBGET integrated database retrieval system