KEGG   Synechocystis sp. PCC 6714: D082_29870
Entry
D082_29870        CDS       T03386                                 

Gene name
odhB
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syj  Synechocystis sp. PCC 6714
Pathway
syj00010  Glycolysis / Gluconeogenesis
syj00020  Citrate cycle (TCA cycle)
syj00620  Pyruvate metabolism
syj01100  Metabolic pathways
syj01110  Biosynthesis of secondary metabolites
syj01120  Microbial metabolism in diverse environments
syj01200  Carbon metabolism
Module
syj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D082_29870 (odhB)
   00020 Citrate cycle (TCA cycle)
    D082_29870 (odhB)
   00620 Pyruvate metabolism
    D082_29870 (odhB)
Enzymes [BR:syj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     D082_29870 (odhB)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: AIE75515
UniProt: A0A068N061
LinkDB
Position
2967749..2969062
AA seq 437 aa
MIYDIFMPALSSTMTEGKIVSWTKSPGDKVEKGETVLVVESDKADMDVESFNEGYLAAIL
VPAGEEAPVGATLGLVAETEAEIAEAQAKAGSGGSSSAGPIPTPTPQQPEPVAIASPTTT
EATPVPSSNGNGKGSGRIIASPRAKKLAKELKVDLVTVAGTGPHGRIVAADIENAAGKPV
SPPVAVPSAPVISAPAAVISTVPSIATPTSTIPVGQTVPLTTFQKALVQNMVAAMAAPTF
RVGYTITTDGLDQLYKQIKGKGVTMTALLAKAVALALKKHPIVNASYTDQGIAYHKDVNI
ALAVAMPDGGLITPVLQNADQVDIYSLSRRWKELVERARAKQLQPEEYSTGTFTISNLGM
FGVDRFDAILPPGQGGILAVGASRPQVVANEEGLIGTKRQMAVNVTCDHRVIYGAHAAAF
LKDLATIIEENPQSLTM
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgatttacgacattttcatgcccgccctgagttccaccatgaccgaggggaaaattgtt
tcctggactaagtcccccggtgacaaagtggaaaaaggtgaaactgtcctggtggtggaa
tcggacaaagcggatatggacgtggaatcttttaacgaaggttacctggccgctatttta
gtgccggctggggaagaagctcccgtgggggcaaccctaggcctagtggcggaaacggaa
gcggaaattgccgaggcccaggctaaagcgggctccggtggtagttctagtgcaggccca
attccaactccgactccccaacagcctgaaccggtggcgatcgccagtccgacaactacg
gaagcaaccccagtccccagcagcaacggtaatggtaaaggcagtggacggatcattgct
tccccgcgggcgaaaaagctagccaaagagttaaaagttgacttggttactgttgctggt
actggcccccacggcagaattgtggccgctgatatcgaaaatgccgctggcaaaccagta
agtcctccggtcgctgtgcccagtgccccagttatcagtgcccctgccgccgttatttcc
actgttccctccattgcaacaccgacttccactatccctgtcggccaaacagtgcccctg
accacattccagaaagcgctggttcaaaatatggtggcggccatggcggctcccactttc
cgggtaggttacaccattaccaccgatggattagaccaactttacaagcaaattaaaggc
aagggagtgactatgacggccctattggccaaagctgtggccctagcgctgaaaaagcac
cccattgtcaacgccagctacactgaccaaggcattgcttaccacaaggatgtcaacatt
gctctggctgtggctatgcccgatggcggcctgatcactccagtgctacaaaacgcagat
caagtggacatctattccctctcccgccgctggaaagagttggtggaacgggccagggct
aaacaattacagccggaggaatacagtactggtactttcactatttctaatctgggcatg
tttggggtggatcgatttgatgccattctgccgcccggtcaggggggaattttggcagtg
ggcgcttcccgtccccaggtggtggctaatgaggaaggcttgattggtactaaacgacaa
atggcagttaatgtgacctgtgaccatcgggtcatttatggagcccatgccgcggctttc
ctaaaagatttggccaccatcattgaggaaaatccccagtctttgactatgtag

DBGET integrated database retrieval system