KEGG   Synechocystis sp. PCC 6714: D082_29870Help
Entry
D082_29870        CDS       T03386                                 

Gene name
odhB
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syj  Synechocystis sp. PCC 6714
Pathway
syj00010  Glycolysis / Gluconeogenesis
syj00020  Citrate cycle (TCA cycle)
syj00620  Pyruvate metabolism
syj01100  Metabolic pathways
syj01110  Biosynthesis of secondary metabolites
syj01120  Microbial metabolism in diverse environments
syj01130  Biosynthesis of antibiotics
syj01200  Carbon metabolism
Module
syj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D082_29870 (odhB)
   00020 Citrate cycle (TCA cycle)
    D082_29870 (odhB)
   00620 Pyruvate metabolism
    D082_29870 (odhB)
Enzymes [BR:syj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     D082_29870 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AIE75515
UniProt: A0A068N061
LinkDB All DBs
Position
2967749..2969062
Genome map
AA seq 437 aa AA seqDB search
MIYDIFMPALSSTMTEGKIVSWTKSPGDKVEKGETVLVVESDKADMDVESFNEGYLAAIL
VPAGEEAPVGATLGLVAETEAEIAEAQAKAGSGGSSSAGPIPTPTPQQPEPVAIASPTTT
EATPVPSSNGNGKGSGRIIASPRAKKLAKELKVDLVTVAGTGPHGRIVAADIENAAGKPV
SPPVAVPSAPVISAPAAVISTVPSIATPTSTIPVGQTVPLTTFQKALVQNMVAAMAAPTF
RVGYTITTDGLDQLYKQIKGKGVTMTALLAKAVALALKKHPIVNASYTDQGIAYHKDVNI
ALAVAMPDGGLITPVLQNADQVDIYSLSRRWKELVERARAKQLQPEEYSTGTFTISNLGM
FGVDRFDAILPPGQGGILAVGASRPQVVANEEGLIGTKRQMAVNVTCDHRVIYGAHAAAF
LKDLATIIEENPQSLTM
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgacattttcatgcccgccctgagttccaccatgaccgaggggaaaattgtt
tcctggactaagtcccccggtgacaaagtggaaaaaggtgaaactgtcctggtggtggaa
tcggacaaagcggatatggacgtggaatcttttaacgaaggttacctggccgctatttta
gtgccggctggggaagaagctcccgtgggggcaaccctaggcctagtggcggaaacggaa
gcggaaattgccgaggcccaggctaaagcgggctccggtggtagttctagtgcaggccca
attccaactccgactccccaacagcctgaaccggtggcgatcgccagtccgacaactacg
gaagcaaccccagtccccagcagcaacggtaatggtaaaggcagtggacggatcattgct
tccccgcgggcgaaaaagctagccaaagagttaaaagttgacttggttactgttgctggt
actggcccccacggcagaattgtggccgctgatatcgaaaatgccgctggcaaaccagta
agtcctccggtcgctgtgcccagtgccccagttatcagtgcccctgccgccgttatttcc
actgttccctccattgcaacaccgacttccactatccctgtcggccaaacagtgcccctg
accacattccagaaagcgctggttcaaaatatggtggcggccatggcggctcccactttc
cgggtaggttacaccattaccaccgatggattagaccaactttacaagcaaattaaaggc
aagggagtgactatgacggccctattggccaaagctgtggccctagcgctgaaaaagcac
cccattgtcaacgccagctacactgaccaaggcattgcttaccacaaggatgtcaacatt
gctctggctgtggctatgcccgatggcggcctgatcactccagtgctacaaaacgcagat
caagtggacatctattccctctcccgccgctggaaagagttggtggaacgggccagggct
aaacaattacagccggaggaatacagtactggtactttcactatttctaatctgggcatg
tttggggtggatcgatttgatgccattctgccgcccggtcaggggggaattttggcagtg
ggcgcttcccgtccccaggtggtggctaatgaggaaggcttgattggtactaaacgacaa
atggcagttaatgtgacctgtgaccatcgggtcatttatggagcccatgccgcggctttc
ctaaaagatttggccaccatcattgaggaaaatccccagtctttgactatgtag

DBGET integrated database retrieval system