KEGG   Synechocystis sp. PCC 6714: D082_30220Help
Entry
D082_30220        CDS       T03386                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
syj  Synechocystis sp. PCC 6714
Pathway
syj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D082_30220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syj02000]
    D082_30220
Enzymes [BR:syj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     D082_30220
Transporters [BR:syj02000]
 Other Transporters
  Pores ion channels [TC:1]
   D082_30220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_C_5 Glutaredoxin GST_N GST_N_4 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIE75550
UniProt: A0A068N097
LinkDB All DBs
Position
3003470..3004669
Genome map
AA seq 399 aa AA seqDB search
MTTPLSWQALAEFADDQIDTINGPTNAQATLRLFGQPEDAVRVTLYRDNHAWCPYCQKVW
LWLEEKQIPYQIKKVTMFCYGEKEAWYKKLVPSGMLPALELDGRFYTESDDILIALEKAF
GPLLWAMEDPLVLPLRKLERLLFRAWCNWLCYPAMFPGTDQRNQQQFQQVVDQVEKALEK
LPGPYFLPEFSTADIVFIPYVERMHASLFYYKGYSLRERNPRLKDWFAALETRMTYRGTQ
SDFHTHAHDLPPQMGGCYSNGSDQAKRNQQRVDNGPWFGLPDATYPEPQNVKQEAIARVM
KHRANIIKVNGHDQGESFDQALRCGLTLLATGEVCTPPQGTDQALRYLRDRINVPRDMSI
YAARHLRQALETTAGLVGHSQGEPIPVRHRRDQDPANFR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgactactcccctttcttggcaagctttagcagaatttgctgatgatcaaattgacacc
atcaatggccctaccaatgcccaggcaactttacggctatttggccaaccggaggatgct
gtgcgagttaccctttatcgggataaccatgcttggtgcccctactgccagaaggtttgg
ttatggttggaagaaaaacaaataccctaccaaatcaaaaaggtgaccatgttttgctat
ggagaaaaagaagcttggtataaaaaattagtgccgtcgggaatgctaccggcattggaa
ttggatggcaggttttacactgaaagtgatgacattctaattgctctggaaaaagctttt
ggtcctctgctctgggccatggaagatcctttggttttacccttgagaaaactggaaaga
ctattatttagagcctggtgtaattggctctgttaccccgccatgtttccggggacagat
caacggaatcaacaacagtttcaacaggtggtagatcaagtggaaaaagcattggaaaaa
ttgcctggcccctattttttaccggaatttagcactgctgatatcgtttttattccctac
gtggagcgcatgcatgccagcttgttttattacaaaggctattccctgcgggagcggaat
ccccgcttaaaagattggtttgcggcgctggaaacccggatgacctatagaggcacccag
agcgatttccatacccatgcccacgatttaccaccccaaatggggggatgttattccaat
ggcagtgatcaggccaaacggaatcaacagcgggtggacaatggcccttggtttggttta
cccgatgccacctatcccgaaccacaaaatgttaagcaggaggcgatcgccagggtgatg
aaacatcgcgcaaatattatcaaggtcaatggccatgaccagggggaaagttttgaccaa
gccctgcgctgtgggttgactctgttagctacgggggaagtatgtacgcctccccagggt
acagaccaggctttgcgttatctgcgggatcgcattaatgtgcccagggatatgtccatt
tacgcggccaggcatctccggcaagcattggaaaccaccgctggtttggtggggcatagc
caaggagaacccattccagtgcgccatcgtcgggatcaggacccagctaattttcgctga

DBGET integrated database retrieval system