KEGG   Synechococcus sp. PCC 7003: AWQ21_00555
Entry
AWQ21_00555       CDS       T05991                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syl  Synechococcus sp. PCC 7003
Pathway
syl00010  Glycolysis / Gluconeogenesis
syl00020  Citrate cycle (TCA cycle)
syl00620  Pyruvate metabolism
syl01100  Metabolic pathways
syl01110  Biosynthesis of secondary metabolites
syl01120  Microbial metabolism in diverse environments
syl01200  Carbon metabolism
Module
syl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWQ21_00555
   00020 Citrate cycle (TCA cycle)
    AWQ21_00555
   00620 Pyruvate metabolism
    AWQ21_00555
Enzymes [BR:syl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWQ21_00555
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Other DBs
NCBI-ProteinID: ANV83013
UniProt: A0A1B1TKY2
LinkDB
Position
109975..111282
AA seq 435 aa
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVAKGETVVVVESDKADMDVESFNEGFLAAII
VDAGEEAPVGSAIALIAETEAEIPEAKQKAADLKGGGSSAPAAAPAPAPAAPSPEPTPTP
AAPTPTPAAPTPAPVVNDGRIIASPRAKKLAKEFGVDLKTVPGSGPHGRIVAEDIEKAAG
KAPTIVPAAVSTPAPTTTKPAAPTPAPVAVAPGEVVPMNTLQQAVVRNMNASLNVPTFHV
SYDITTDALDALYKQIKSKGVTMTGLLAKAVAVTLQKHPVVNASFGDNAIQYSSGINVAV
AVAMPDGGLITPVLQNADQMDIYSLSRKWKDLVDRARLKQLQPDEYSTGTFTLSNLGMFG
VNSFDAILPPGQGSILAIGGAQPKVVATPDGLFGVKKQMTVNITCDHRIIYGADAAAFLK
DLADLIENNTHSLTL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgattcacgatattttcatgcccgccctcagctctacgatgaccgaaggtaaaatcgtc
tcttggactaagtccccgggggataaagtcgctaaaggtgaaaccgttgtcgtggtggaa
tctgacaaagccgatatggacgttgagtcttttaacgaagggtttcttgcagcgattatt
gttgatgcgggagaagaagcaccagtgggttcggcgatcgccctcattgccgaaaccgaa
gcagaaatcccagaggctaaacaaaaagccgctgacctaaaaggagggggtagtagtgct
cctgccgctgcaccagcacctgcgcctgccgcacctagtccagagccgacccccacacct
gcggcaccgacccccacacctgcggcaccgacccctgcccccgtggtcaatgatggcaga
attattgcttctccgagggcgaaaaaactcgccaaagaatttggcgttgatctcaaaaca
gttcctggctctggcccccacggtcgcatcgtcgccgaagatatcgaaaaagcagccggt
aaagcgcccactatcgtcccagccgccgtctcaactcccgccccgacaaccactaaacct
gcagcccccacaccggcccctgtcgccgttgcgcctggtgaagtcgtcccgatgaatacg
ttgcaacaggcggttgtgcgtaacatgaatgccagcctgaatgtgcctaccttccatgta
tcctatgacatcacaaccgatgccctagatgctctctacaagcaaattaagagtaagggc
gtcaccatgacaggtcttctagccaaggcggtggctgtgactctccagaaacacccagtg
gtcaatgccagcttcggggataacgcaatccaatacagcagtggcattaatgtggcggtg
gccgtcgccatgccggatggtggtctgattacccctgtgctccaaaatgccgatcaaatg
gatatctattccctttcccgcaagtggaaagatttggtagaccgggcgcgcctcaagcaa
ttgcagcccgatgagtacagcactggtacctttaccctctctaacttagggatgtttggg
gtcaatagttttgatgcgattttaccccccggccaaggttcaatcctcgcgattggtggt
gcccagcccaaagtggttgcgacgcccgatggcttgtttggtgtgaaaaagcaaatgacc
gtcaatattacctgcgaccaccgcattatttacggtgctgatgcagcggcattcctcaag
gatctagctgacttgatcgaaaacaatacccacagcttgaccctttag

DBGET integrated database retrieval system