KEGG   Synechococcus sp. PCC 7003: AWQ21_00555Help
Entry
AWQ21_00555       CDS       T05991                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syl  Synechococcus sp. PCC 7003
Pathway
syl00010  Glycolysis / Gluconeogenesis
syl00020  Citrate cycle (TCA cycle)
syl00620  Pyruvate metabolism
syl01100  Metabolic pathways
syl01110  Biosynthesis of secondary metabolites
syl01120  Microbial metabolism in diverse environments
syl01130  Biosynthesis of antibiotics
syl01200  Carbon metabolism
Module
syl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWQ21_00555
   00020 Citrate cycle (TCA cycle)
    AWQ21_00555
   00620 Pyruvate metabolism
    AWQ21_00555
Enzymes [BR:syl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWQ21_00555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Motif
Other DBs
NCBI-ProteinID: ANV83013
UniProt: A0A1B1TKY2
LinkDB All DBs
Position
109975..111282
Genome map
AA seq 435 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVAKGETVVVVESDKADMDVESFNEGFLAAII
VDAGEEAPVGSAIALIAETEAEIPEAKQKAADLKGGGSSAPAAAPAPAPAAPSPEPTPTP
AAPTPTPAAPTPAPVVNDGRIIASPRAKKLAKEFGVDLKTVPGSGPHGRIVAEDIEKAAG
KAPTIVPAAVSTPAPTTTKPAAPTPAPVAVAPGEVVPMNTLQQAVVRNMNASLNVPTFHV
SYDITTDALDALYKQIKSKGVTMTGLLAKAVAVTLQKHPVVNASFGDNAIQYSSGINVAV
AVAMPDGGLITPVLQNADQMDIYSLSRKWKDLVDRARLKQLQPDEYSTGTFTLSNLGMFG
VNSFDAILPPGQGSILAIGGAQPKVVATPDGLFGVKKQMTVNITCDHRIIYGADAAAFLK
DLADLIENNTHSLTL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatattttcatgcccgccctcagctctacgatgaccgaaggtaaaatcgtc
tcttggactaagtccccgggggataaagtcgctaaaggtgaaaccgttgtcgtggtggaa
tctgacaaagccgatatggacgttgagtcttttaacgaagggtttcttgcagcgattatt
gttgatgcgggagaagaagcaccagtgggttcggcgatcgccctcattgccgaaaccgaa
gcagaaatcccagaggctaaacaaaaagccgctgacctaaaaggagggggtagtagtgct
cctgccgctgcaccagcacctgcgcctgccgcacctagtccagagccgacccccacacct
gcggcaccgacccccacacctgcggcaccgacccctgcccccgtggtcaatgatggcaga
attattgcttctccgagggcgaaaaaactcgccaaagaatttggcgttgatctcaaaaca
gttcctggctctggcccccacggtcgcatcgtcgccgaagatatcgaaaaagcagccggt
aaagcgcccactatcgtcccagccgccgtctcaactcccgccccgacaaccactaaacct
gcagcccccacaccggcccctgtcgccgttgcgcctggtgaagtcgtcccgatgaatacg
ttgcaacaggcggttgtgcgtaacatgaatgccagcctgaatgtgcctaccttccatgta
tcctatgacatcacaaccgatgccctagatgctctctacaagcaaattaagagtaagggc
gtcaccatgacaggtcttctagccaaggcggtggctgtgactctccagaaacacccagtg
gtcaatgccagcttcggggataacgcaatccaatacagcagtggcattaatgtggcggtg
gccgtcgccatgccggatggtggtctgattacccctgtgctccaaaatgccgatcaaatg
gatatctattccctttcccgcaagtggaaagatttggtagaccgggcgcgcctcaagcaa
ttgcagcccgatgagtacagcactggtacctttaccctctctaacttagggatgtttggg
gtcaatagttttgatgcgattttaccccccggccaaggttcaatcctcgcgattggtggt
gcccagcccaaagtggttgcgacgcccgatggcttgtttggtgtgaaaaagcaaatgacc
gtcaatattacctgcgaccaccgcattatttacggtgctgatgcagcggcattcctcaag
gatctagctgacttgatcgaaaacaatacccacagcttgaccctttag

DBGET integrated database retrieval system