KEGG   Synechococcus sp. PCC 7003: AWQ21_03005Help
Entry
AWQ21_03005       CDS       T05991                                 

Definition
(GenBank) RNB domain-containing ribonuclease
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
syl  Synechococcus sp. PCC 7003
Brite
KEGG Orthology (KO) [BR:syl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:syl03016]
    AWQ21_03005
Enzymes [BR:syl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     AWQ21_03005
Transfer RNA biogenesis [BR:syl03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    AWQ21_03005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB RNase_II_C_S1
Motif
Other DBs
NCBI-ProteinID: ANV83435
UniProt: A0A1B1TM47
LinkDB All DBs
Position
633843..635855
Genome map
AA seq 670 aa AA seqDB search
MEKGQLIEFRLQGERVLAVAERPEGKKDWIVIDGRGQSHKLRPQRVEYTVAGSPYDPTEI
PSFSTESQALVDPDNLAVAWEFLVEASEQATPESLAQLLFSTKTPQQCYACHLMLAEDKI
FFKRKGDYYEPRSEAQVREIQHQLEVEAQKEREKTEFLQRVNQAIAGETVTWEDSDRQRF
ESLERFVLYPEQSAKAAHDLLEMLGRSPTTEQAFRLLVSLGWWSSHENLALLRSGYPRKF
SQKVLDVSHVRLSASPGDTDEGNRIDLTHLKTYTIDDESTSEIDDGLSIETLENGLHKVW
IHIADPTRLLSPGDELDLEARRRSTSLYLPTGMISMFPEELATGPMSLRQGQVCAALSFG
VLLTDNGAIADYEITPSWVKPTYRLTYDDVDEMLHLRIQAESEIALLADFAHKRRKWRDA
QGSISIKMPEASIKVQDENVFIEVLHASMSRELVAEMMILAGEVAGHYGRTHCLPLPFRG
QPQPELPPQEELLLLPAGPVRACAVRRCMPRSEMGTNPVRHASLGLDSYIQVTSPIRRYT
DLLAHFQIKAHLRGDELPFSVDELKEILYSVVTSSQEAVHVERQTNRYWSLEYLRRNADQ
VWQGLVLRWLREDEKLGIILLEELGLELPHRFERAVALGDRLEVKVSQADPHKDEIRFRE
LLETEIAAAS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaggacaactgatcgagtttcggctacagggagaacgagtacttgctgtcgct
gagcgtcctgaaggaaaaaaagattggatcgtaatcgatggacgggggcaatcccataag
ctgcgtccccaaagggttgaatataccgtggcgggttccccctacgatccaaccgagatc
cccagcttttccacagaaagtcaggcattagttgatcccgataacctcgccgtcgcctgg
gaatttctcgtcgaagcctcggaacaggcaaccccagaatccctcgcgcaacttttgttt
tcgacgaaaacgccccagcaatgttatgcctgtcacctaatgctggcggaagacaagatt
ttctttaaacgcaaaggggactactacgagccccgttcagaggcgcaagttcgagagatt
caacatcagctagaagttgaagcccaaaaagagcgcgaaaaaacagaatttttacagcgg
gttaaccaggcgatcgccggggaaacagtaacctgggaagacagcgatcggcaacgtttc
gaaagcctagaaagatttgtcctctacccagaacaatcggccaaagccgcccacgacctc
ctcgagatgctggggcgatcgcccacaaccgaacaggcattccgcctcttagtttccctt
gggtggtggagttcccacgaaaatcttgctctcctccggagcggttaccccagaaaattt
tctcagaaggtactcgatgtgtcccatgtccgcctgtcagcctcacccggtgataccgat
gaggggaaccgtatcgatttaacccatctcaaaacctacaccattgacgatgagagcacc
tcggaaattgacgatggcctcagtattgaaactttagaaaatggcctgcataaagtttgg
atccacatcgctgatcccacacgcttactaagccctggggatgaacttgatctagaagcc
cgccgtcgcagtaccagcctctatttacccacggggatgatctccatgttcccggaagag
ttggcgacggggcccatgagcttgcgccaaggacaggtctgtgctgctctcagttttggg
gttttgctcacagataatggggcgatcgccgattatgaaattacccccagttgggtgaag
cccacctaccgcctgacctatgacgacgtggacgaaatgctccatctgcggatccaggcc
gaatcagaaattgccctcctcgcggattttgcccacaaacgccgaaagtggcgggatgcc
caaggctccattagcatcaagatgcccgaagcctccattaaggtgcaggatgaaaacgtt
ttcatcgaagtcctccatgcctcgatgtcccgggaactggttgcggaaatgatgatcctt
gccggcgaagtggcaggtcattatggccgcacccattgtttacctttgcctttccgggga
caaccccagccggaactccccccccaagaagaacttttgttattacccgccgggcctgtg
cgcgcctgtgccgtacggcgttgtatgccccgcagtgaaatggggacaaatcctgtgcgc
catgccagtttgggattagattcctatatccaagtcacatcgcccattcgtcgttatacg
gatctattagcccatttccaaattaaggcccatctgcggggggatgaactgcctttctca
gtagatgaactcaaggaaattctctacagcgttgtcacttctagtcaggaagctgtccat
gtggagcgccaaaccaaccgctattggagcctcgaatatttacgtcgtaatgcggatcaa
gtgtggcagggtttagttctgcgctggctccgggaagatgaaaagttaggcattattctc
ctggaagagctgggcctagagcttccccatcgctttgaacgggccgttgccctaggcgat
cgcctggaagtaaaagtaagccaggccgatccccacaaagatgaaattcgcttccgggaa
ctgctcgaaacggagattgcggcggcctcctag

DBGET integrated database retrieval system