KEGG   Synechocystis sp. PCC 6803: sll1085Help
Entry
sll1085           CDS       T00004                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00564  Glycerophospholipid metabolism
syn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    sll1085 (glpD)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     sll1085 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: BAA18351
CyanoBase: sll1085
CYORF: sll1085
UniProt: P74257
LinkDB All DBs
Position
complement(1945518..1947179)
Genome map
AA seq 553 aa AA seqDB search
MRNFPEIQNTAYDLIVIGGGINGVGTARDGALRGLKTLLIEKDDFASGTSSWSTRLIHGG
LRYLEYFEFNLVRESLREREVLLHTAPHLVQPLQLTIPVYDWSSRAYWEIQAGMILYDIL
SFDKTLPSHRMLSPQQFQQLFRAAEKKGLKGGAQYFDGQVEYAERLDLEVTLSAQKAGAA
MLNYVAVKGLEKGENNLITAIHCQDQLSGEKFTVNSAQAIVINTTGPWVDEVCGLAHRGG
EPVAIVQERKIGGTKGSHIVVDPFPGAPASALYVEAFVDKRPYFIIPWLGKYLIGTTDHR
YDGSLDRVKASDDEIDYLIAETNRVMPAAQLTRQDVRFTYSGVRPLPYTDGKKAGSITRN
HILYDHSQDGVNNLISLIGGKLTTYRQVGEEMVDKVYGKLRRSAPPCPTLTQPLPGAEAY
PLSLETAMDKYGNHLERHSIQHLFCLYGARAGDILALVHGAPELGERIIPSLPDIKAQVV
FAVQAEMAHTLVDICRRRTAIAMVTNDYGFSALAGICQTLTDHCGWTQEQCDKQIQKYHE
YMEQNCIPDYCLH
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatttcccagaaatccaaaatacggcctatgacctaattgtgattgggggaggc
attaacggggttggcacggcccgggacggagccctacggggcctaaaaaccctcctgatc
gaaaaggatgatttcgccagtggtacgagtagttggtccacccgcttaatccatggcggc
ctgcgctatctggaatattttgaatttaatctggtgcgggaatccctgcgggagcgggaa
gttctgctccacaccgccccccatttggtccagcccctccagttgaccattccggtgtac
gactggtcgagccgggcctattgggaaattcaggcgggcatgattctttacgacatcctc
agttttgataaaaccctcccttcccataggatgttaagcccccaacagttccagcaactg
ttccgagcggcggagaaaaaaggcttaaaaggaggagcccaatattttgacggccaggtg
gaatatgcggaacggttagatttagaagtgaccctatcggcccaaaaggccggggcggcc
atgctcaattatgtggctgtgaaggggttggagaaaggggaaaataacctgattaccgcc
atccattgccaggatcaactgagcggagaaaaatttactgttaatagcgcccaggcgatc
gtcattaataccactggcccctgggtagatgaagtttgtggcttagcccatcgaggggga
gaacccgttgccattgtccaagaaagaaaaattggtggcaccaagggcagtcatattgtg
gtggatcccttccctggagcccccgcttcagccttatatgtggaagcgtttgtggataaa
cggccctatttcatcattccctggttgggtaaatatctgattggcaccacggaccaccgc
tatgatggttccctcgacagggttaaagccagtgatgacgagattgattacctgattgcg
gaaactaaccgggtgatgccagcagctcagttaaccaggcaggatgtgcgtttcacctat
tccggggtgcgccctctgccctacaccgatggcaaaaaggccggcagtattacccgcaac
catattctttatgaccatagtcaagacggagttaataatttgatttccctaattggcggt
aagttgaccacctatcgccaggtgggagaagaaatggtggataaggtttatggcaagctg
agacgctctgctcctccctgtccaaccctgacccaacctttaccgggggcagaagcctat
cccctgtccttggaaactgccatggataaatatggcaatcatttggagcgtcattctatt
caacatttattttgcctttacggagccagggctggagacattttagccttagtccacgga
gcgccggagttgggggaaaggattattccttccttgccggatatcaaagcccaagttgtt
tttgcagtacaagcagaaatggcccacaccttggtggatatttgtcgacgacgtacggcg
atcgccatggtgactaacgattatggctttagcgccctggccggcatttgccaaacgtta
acagaccattgtggctggacccaggagcaatgtgacaagcaaattcaaaagtaccatgaa
tatatggagcaaaactgcattcccgactattgtctccactga

DBGET integrated database retrieval system