KEGG   Synechocystis sp. PCC 6803: sll1377Help
Entry
sll1377           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K19003  1,2-diacylglycerol 3-beta-glucosyltransferase [EC:2.4.1.336]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00561  Glycerolipid metabolism
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    sll1377
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:syn01003]
    sll1377
Enzymes [BR:syn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.336  monoglucosyldiacylglycerol synthase
     sll1377
Glycosyltransferases [BR:syn01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   sll1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: BAA18254
CyanoBase: sll1377
CYORF: sll1377
UniProt: P74165
LinkDB All DBs
Position
complement(1836691..1838130)
Genome map
AA seq 479 aa AA seqDB search
MPQFPWKDNDAELSPLEAFLAEWDDPEAEEEDFRNDFFRGSEGRRKKAAVMLMAIWTVVI
TLHYWVWGSWLVWALTGALSLQALRLMKATPEEAPPLLTGDASTVPYPQVCLMVAAKNEE
AVIGKIVQQLCSLDYPGDRHEVWIVDDNSTDRTPAILDQLRQQYPQLKVVRRGAGASGGK
SGALNEVLAQTQGDIVGVFDADANVPKDLLRRVVPYFASPTFGALQVRKAIANEAVNFWT
RGQGAEMALDAYFQQQRIVTGGIGELRGNGQFVARQALDAVGGWNEQTITDDLDLTIRLH
LHQWKVGILVNPPVEEEGVTTAIALWHQRNRWAEGGYQRYLDYWRWICTQPMGWKKKLDL
FSFLLMQYLLPTAAVPDLLMALWQRRFPLLTPLSYLAIGFSCWGMYYGLKRLTPSEGESP
WQQMPALLARTIGGTIYMFHWLIIMPAVTARMAFRPKRLKWVKTVHGAATEDALELKQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatttccgtggaaagataacgatgccgagctgtcccccttagaagccttccta
gccgaatgggatgatcccgaagcggaggaggaggattttcgcaacgatttcttccgggga
tcggaggggcggcgcaaaaaagcagcggtaatgcttatggccatttggacagtcgtcatc
actctccattactgggtttggggcagttggctggtgtgggccctcaccggtgccctctct
ttgcaggctctcaggttaatgaaagcaaccccagaagaagccccccccctgcttactgga
gatgcatccacggtgccctatccccaggtttgtttaatggtggccgccaaaaatgaagag
gcggtaattggcaaaattgtgcagcagttatgctctttggactatcccggcgatcgccat
gaagtttggattgtggacgataacagcactgaccggactccggccatcttggaccaacta
cgtcagcagtatccccagttaaaagtagtaaggagaggcgcgggggccagtggcggtaaa
tcaggggctttaaatgaagtgttagcccaaacccaaggggacatcgttggcgtatttgat
gccgatgccaatgtgcccaaagatttactgcggcgggtggtgccctattttgcttcaccg
acttttggggctctacaagtacgcaaagcgatcgccaacgaagctgtcaatttttggacc
aggggccagggggcggaaatggccctagatgcctattttcaacagcagagaatcgttacc
ggcggcattggagaactgcggggtaatggtcaatttgtggcccgccaagccctagatgcg
gtgggcggctggaatgagcagaccatcaccgatgatttagacttaaccattcgcttacat
ctccaccagtggaaagtgggtattttagtcaatcccccggtggaagaagagggagtcacc
acggcgatcgccctttggcaccaacgtaatcgctgggcggaaggcggctaccaacgatac
ctcgactattggcgctggatttgcacccaacccatgggctggaagaaaaagttggatttg
ttttcctttctattaatgcaatatcttttacccaccgccgctgtaccggatttactcatg
gccctgtggcaaagacgttttcccctgctcactcccctcagttatctggcgatcggtttt
tcctgttggggcatgtactacggactaaagcgcttaactcccagcgaaggcgaatctcct
tggcaacaaatgccggccctactagctcgcaccatcggtggcaccatttatatgttccac
tggctgatcattatgcccgccgtcaccgcccgcatggcttttcgccccaaacgactcaag
tgggtgaaaacggtccacggtgctgctacggaggatgcccttgagctgaaacaaagttaa

DBGET integrated database retrieval system