KEGG   Synechocystis sp. PCC 6803: sll1641Help
Entry
sll1641           CDS       T00004                                 

Gene name
gad
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00250  Alanine, aspartate and glutamate metabolism
syn00410  beta-Alanine metabolism
syn00430  Taurine and hypotaurine metabolism
syn00650  Butanoate metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01120  Microbial metabolism in diverse environments
syn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    sll1641 (gad)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    sll1641 (gad)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    sll1641 (gad)
   00430 Taurine and hypotaurine metabolism
    sll1641 (gad)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    sll1641 (gad)
Enzymes [BR:syn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     sll1641 (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAA17064
CyanoBase: sll1641
CYORF: sll1641
UniProt: P73043
LinkDB All DBs
Position
complement(543468..544871)
Genome map
AA seq 467 aa AA seqDB search
MVHKKIDLNQLSEAESLLTPTYAARGLANSVSKYEMPETEMLPAIAYNLIHDELGLDGNS
RLNLATFVTTWMEPEARQLMADTFDKNMIDKDEYPQTAEIELRCVNILSRLWNAPASAEA
TGCSTIGSSEAAMLGGMAMKWKWRQRRQAAGKPGDRPNLVMGINVQVCWEKFCRYWEVEP
RFVPMEGDRYHISPEEAVKLIDENTIGVIGILGSTFDGSYEPIEALNDALETLNQRTGWQ
VPLHIDAASGGFIAPFLDPDLRWDFRLPWVKSINTSGHKYGLVYPGVGWIIWRDKEELPE
ELIFHCNYLGGDLPNFALNFSRPGNQVVAQYYNFLRLGKEGYRKIQQTCRDTALYLSGKI
AQLGPFELLTDGGDIPVFAWRLKDEVLANTCYTLYDMADKLRERGWLVPAYRMPKNREDL
VVQRIVVKEGFSRDMADLLLADMERAIAYFASQPDHKPKQEGSHFSH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtgcataaaaaaattgacctcaaccagctcagtgaagcggaaagcctactgaccccc
acctatgcggcccggggcctagccaattctgtcagtaaatatgaaatgccagaaacggaa
atgctaccggcgatcgcctataacctcatccacgatgaactggggctagatggcaattcc
cgattaaacctggccacctttgtcaccacttggatggagccggaagctaggcaactgatg
gcggataccttcgacaaaaacatgatcgataaggatgaatatccccaaacggcggaaatt
gagttgcgttgcgtcaatattttgtcccgactctggaatgctccggccagtgcggaagcc
accggctgttccaccattggttctagtgaagcggccatgttgggggggatggccatgaag
tggaaatggcggcaacgacgacaagcggcagggaaaccaggcgatcgcccgaatttggtt
atgggcattaacgtccaggtttgttgggaaaagttttgtcgttactgggaagtggaaccc
cgctttgtccccatggaaggcgatcggtaccacatcagcccggaagaagcagttaagcta
attgacgaaaataccatcggtgtaattggtattttaggtagcacctttgacggcagttat
gaacccattgaagcgttgaacgatgccctggaaactttaaatcaaagaactggttggcag
gtgcctctgcacatagatgccgccagcggtggttttattgctccctttttagatccagat
ttgcgttgggattttcgtttaccttgggtgaaatccatcaacacctctggccacaaatac
ggtttagtttatccgggggtaggttggatcatttggcgggataaggaagaattaccggaa
gaattaattttccattgcaactatttggggggagatttacccaactttgccctcaacttt
tcccgccccggcaatcaggtagtggcccagtattataactttctccgcttaggcaaagaa
ggttaccgcaaaatccaacagacttgtcgagatacggctctgtatctatctggcaaaatt
gcccaattaggcccttttgaattgctcaccgacggtggggatatcccggtttttgcctgg
agattaaaggacgaagtattggccaacacttgttataccctgtacgacatggccgacaaa
ttgcgggaacggggctggttggtgcccgcctatcgcatgcccaaaaaccgtgaagatttg
gtggtgcaacgcattgtcgtgaaagagggttttagtcgggatatggcggaccttttgtta
gcggacatggaaagggcgatcgcctattttgccagccaaccggaccacaaaccgaagcag
gaaggttcccactttagccattag

DBGET integrated database retrieval system